Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_Q9HBZ3 Zinc finger transcription factor BTEB2 (Fragment) n=2 Tax=Homo sapiens TaxID=9606 RepID=Q9HBZ3_HUMAN MATRVLSMSARLGPVPQPPAPQDEPVFAQLKPVLGAANPARDAALFPGEELKHAHHRPQA QPAPAQAPQPPSPPPPAAAASRGPG

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9HBZ3Q9HBZ3_HUMANZinc finger transcription factor BTEB2 (Fragment)Homo sapiens (Human)9606UniRef100_Q9HBZ3
85Representative & Seed
A0A0A0N0L4A0A0A0N0L4_HUMANKlf5C isoformHomo sapiens (Human)9606UniRef100_A0A0A0N0L4
74

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9HBZ3

Checksumi: 2E046F0AB32A74BE

FASTA858,684
        10         20         30         40         50
MATRVLSMSA RLGPVPQPPA PQDEPVFAQL KPVLGAANPA RDAALFPGEE
60 70 80
LKHAHHRPQA QPAPAQAPQP PSPPPPAAAA SRGPG
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again