Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P96379 Nucleoside triphosphate pyrophosphohydrolase n=76 Tax=Mycobacterium TaxID=1763 RepID=MAZG_MYCTU MIVVLVDPRRPTLVPVEAIEFLRGEVQYTEEMPVAVPWSLPAARSAHAGNDAPVLLSSDP NHPAVITRLAAGARLISAPDSQRGERLVDAVAMMDKLRTAGPWESEQTHDSLRRYLLEET YELLDAVRSGSVDQLREELGDLLLQVLFHARIAEDASQSPFTIDDVADTLMRKLGNRAPG VLAGESISLEDQLAQWEAAKASEKARKSVADDVHTGQPALALAQKVIQRAQKAGLPAHLI PDEITSVSVSADVDAENTLRTAVLDFIDRLRCAERAIAVARRGSNVAEQLDVTPLGVITE QEWLAHWPTAVNDSRGGSKKRKGMR

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 76  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P96379MAZG_MYCTUNucleoside triphosphate pyrophosphohydrolaseMycobacterium tuberculosis (strain ATCC 25618 / H37Rv)83332UniRef100_P96379
325Representative
A0A0E7YXB3A0A0E7YXB3_MYCTXNucleoside triphosphate pyrophosphohydrolaseMycobacterium tuberculosis1773UniRef100_P96379
326Seed
A0A0H3L769A0A0H3L769_MYCTENucleoside triphosphate pyrophosphohydrolaseMycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman)652616UniRef100_P96379
326
A0A109S6W1A0A109S6W1_MYCBINucleoside triphosphate pyrophosphohydrolaseMycobacterium tuberculosis variant bovis BCG33892UniRef100_P96379
326
A0A109SV53A0A109SV53_MYCTXNucleoside triphosphate pyrophosphohydrolaseMycobacterium tuberculosis variant africanum33894UniRef100_P96379
326
A0A045K983A0A045K983_MYCTXNucleoside triphosphate pyrophosphohydrolaseMycobacterium tuberculosis1773UniRef100_P96379
325
A0A328GTZ4A0A328GTZ4_MYCTXNucleoside triphosphate pyrophosphohydrolaseMycobacterium tuberculosis variant pinnipedii194542UniRef100_P96379
325
A0A501P3D3A0A501P3D3_9MYCONucleoside triphosphate pyrophosphohydrolaseMycobacterium orygis1305738UniRef100_P96379
325
A0A1R3XX33A0A1R3XX33_MYCBOConserved proteinMycobacterium bovis (strain ATCC BAA-935 / AF2122/97)233413UniRef100_P96379
325
A0A0H3M3S1A0A0H3M3S1_MYCBPMazG domain-containing proteinMycobacterium bovis (strain BCG / Pasteur 1173P2)410289UniRef100_P96379
325
G0TGD2G0TGD2_MYCCPMazG domain-containing proteinMycobacterium canettii (strain CIPT 140010059)1048245UniRef100_P96379
325
Q7D8Z6Q7D8Z6_MYCTOTranscriptional regulator, MazG familyMycobacterium tuberculosis (strain CDC 1551 / Oshkosh)83331UniRef100_P96379
294
R4MEZ9R4MEZ9_MYCTXNucleoside triphosphate pyrophosphohydrolaseMycobacterium tuberculosis CAS/NITR2041310114UniRef100_R4MEZ9
325
A5U164A5U164_MYCTAMazG domain-containing proteinMycobacterium tuberculosis (strain ATCC 25177 / H37Ra)419947UniRef100_A5U164
325
A0A2I7W5C2A0A2I7W5C2_MYCTXNucleoside triphosphate pyrophosphohydrolaseMycobacterium tuberculosis1773UniRef100_A0A2I7W5C2
325
R4LW50R4LW50_MYCTXNucleoside triphosphate pyrophosphohydrolaseMycobacterium tuberculosis str. Haarlem/NITR2021304279UniRef100_R4LW50
325
UPI00111E8D36nucleoside triphosphate pyrophosphohydrolaseMycobacterium tuberculosis1773UniRef100_P96379
323
UPI0011202813nucleoside triphosphate pyrophosphohydrolaseMycobacterium tuberculosis1773UniRef100_P96379
321
UPI00111F7875nucleoside triphosphate pyrophosphohydrolaseMycobacterium tuberculosis1773UniRef100_P96379
320
UPI00112021E1nucleoside triphosphate pyrophosphohydrolaseMycobacterium tuberculosis1773UniRef100_P96379
319
UPI001120BB01nucleoside triphosphate pyrophosphohydrolaseMycobacterium tuberculosis complex77643UniRef100_P96379
318
UPI000E2EE233nucleoside triphosphate pyrophosphohydrolaseMycobacterium tuberculosis1773UniRef100_P96379
316
UPI00111E1609nucleoside triphosphate pyrophosphohydrolaseMycobacterium tuberculosis1773UniRef100_P96379
313
UPI000E2EF2C2nucleoside triphosphate pyrophosphohydrolaseMycobacterium tuberculosis1773UniRef100_P96379
295
UPI000E2EE9EBnucleoside triphosphate pyrophosphohydrolaseMycobacterium tuberculosis1773UniRef100_P96379
222

Sequence

Representative sequenceiLengthMass (Da)Tools
P96379

Checksumi: 5F54377B761D1509

FASTA32535,413
        10         20         30         40         50
MIVVLVDPRR PTLVPVEAIE FLRGEVQYTE EMPVAVPWSL PAARSAHAGN
60 70 80 90 100
DAPVLLSSDP NHPAVITRLA AGARLISAPD SQRGERLVDA VAMMDKLRTA
110 120 130 140 150
GPWESEQTHD SLRRYLLEET YELLDAVRSG SVDQLREELG DLLLQVLFHA
160 170 180 190 200
RIAEDASQSP FTIDDVADTL MRKLGNRAPG VLAGESISLE DQLAQWEAAK
210 220 230 240 250
ASEKARKSVA DDVHTGQPAL ALAQKVIQRA QKAGLPAHLI PDEITSVSVS
260 270 280 290 300
ADVDAENTLR TAVLDFIDRL RCAERAIAVA RRGSNVAEQL DVTPLGVITE
310 320
QEWLAHWPTA VNDSRGGSKK RKGMR
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again