Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P29780 Putative inosamine-phosphate amidinotransferase 2 n=6 Tax=Streptomyces TaxID=1883 RepID=STRB2_STRGR MSLVGVHNEWDPLEEVVVGTARRPCAGPDRSLLAVEYAEYAGPGRWQEVPTGPYPDRALK ETEDELEELCEELRGLGVTVRRPGARDSAAPVRTPDWESDGYGDLCPRDGLLVVGDTVIE APMALRARFLESLAYKELLVEYLAAGSRWISAPKPRLAEGMYSPSGPSGERLRDLEPVFD AANVLRLGTDLLYLVSDSGNELGARWLQSALGAAYTVHPCRGLYSSTHIDSTLVPLRPGL VLVNPARVTDDNLPGVLRTWQRIECPALAGLGYAGDVPHCSTWIGMSLLVVRPGLVVVDS RHRELMRVLERHGVDVLPLKLTHARMLGGGFHGVTLDIRRTGALETYRF

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 6 of 6  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P29780STRB2_STRGRPutative inosamine-phosphate amidinotransferase 2Streptomyces griseus1911UniRef100_P29780
349Representative
A0A2X2LVF2A0A2X2LVF2_STRGRScyllo-inosamine-4-phosphate amidinotransferaseStreptomyces griseus1911UniRef100_A0A2X2LVF2
350
Q53ID6Q53ID6_STRGRPutative scyllo-inosamine-4-phosphate amidinotransferase StrB2Streptomyces griseus subsp. griseus67263UniRef100_A0A2X2LVF2
350Seed
G0Q7L2G0Q7L2_9ACTNScyllo-inosamine-4-phosphate amidinotransferaseStreptomyces sp. ACT-11609288UniRef100_A0A2X2LVF2
350
B1W373B1W373_STRGGPutative scyllo-inosamine-4-phosphate amidinotransferaseStreptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350)455632UniRef100_A0A2X2LVF2
350
UPI00081BB93Ainosamine-phosphate amidinotransferase 1Streptomyces sp. OspMP-M431839781UniRef100_UPI00081BB93A
350

Sequence

Representative sequenceiLengthMass (Da)Tools
P29780

Checksumi: 6C49FA018C3ABAA7

FASTA34938,219
        10         20         30         40         50
MSLVGVHNEW DPLEEVVVGT ARRPCAGPDR SLLAVEYAEY AGPGRWQEVP
60 70 80 90 100
TGPYPDRALK ETEDELEELC EELRGLGVTV RRPGARDSAA PVRTPDWESD
110 120 130 140 150
GYGDLCPRDG LLVVGDTVIE APMALRARFL ESLAYKELLV EYLAAGSRWI
160 170 180 190 200
SAPKPRLAEG MYSPSGPSGE RLRDLEPVFD AANVLRLGTD LLYLVSDSGN
210 220 230 240 250
ELGARWLQSA LGAAYTVHPC RGLYSSTHID STLVPLRPGL VLVNPARVTD
260 270 280 290 300
DNLPGVLRTW QRIECPALAG LGYAGDVPHC STWIGMSLLV VRPGLVVVDS
310 320 330 340
RHRELMRVLE RHGVDVLPLK LTHARMLGGG FHGVTLDIRR TGALETYRF
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again