Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_A0A0D2T1Z4 HTH myb-type domain-containing protein n=17 Tax=Malvoideae TaxID=214907 RepID=A0A0D2T1Z4_GOSRA MIEMHDEEQGEDVCAMPSRSRKCSSFDLNDEAGSERDCIGETSVEEEEIENITEGSSSNN NNGNGNDRRRVRQYVRSKLPRLRWTPDLHYSFVRAVERLGGQERATPKLVLQLMNVRGLS IAHVKSHLQMYRSKKLDEAGQVLSQSKRAIQGRGEFGSLLCQAITTLSPHHGHQQQHFRM ENGGIVLASESLDGSNTTFKANFPRHHQFPNSFISKAFGQENGFYIQNQIHGTGPIRAMA SRFLEEKRWHPFERISNRWKVNGNMYKDMQSQSHCFWQRPSSDEDKHEPLTKFSSCRTEF EWNQDKVLKDGERLPDLQLRLSQRNGKFDEEKNNHCKGTHEISTQLSLS

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 17 of 17  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A0D2T1Z4A0A0D2T1Z4_GOSRAHTH myb-type domain-containing proteinGossypium raimondii (New World cotton)29730UniRef100_A0A0D2T1Z4
349Representative
A0A0D2ULW1A0A0D2ULW1_GOSRAUncharacterized proteinGossypium raimondii (New World cotton)29730UniRef100_A0A0D2T1Z4
236
A0A5D2AWC7A0A5D2AWC7_GOSDAHTH myb-type domain-containing proteinGossypium darwinii (Darwin's cotton) (Gossypium barbadense var. darwinii)34276UniRef100_A0A5D2AWC7
349Seed
A0A5D2T5T3A0A5D2T5T3_GOSMUHTH myb-type domain-containing proteinGossypium mustelinum (Cotton)34275UniRef100_A0A5D2AWC7
349
A0A5D2J110A0A5D2J110_GOSTOHTH myb-type domain-containing proteinGossypium tomentosum (Hawaiian cotton) (Gossypium sandvicense)34277UniRef100_A0A5D2AWC7
349
A0A5B6WBN5A0A5B6WBN5_9ROSITwo-component response regulator ARR14-likeGossypium australe47621UniRef100_A0A5B6WBN5
349
Q6DXR2Q6DXR2_GOSHIPutative MYB transcription factorGossypium hirsutum (Upland cotton) (Gossypium mexicanum)3635UniRef100_Q6DXR2
349
A0A5J5PQ67A0A5J5PQ67_GOSBAHTH myb-type domain-containing proteinGossypium barbadense (Sea-island cotton) (Egyptian cotton)3634UniRef100_A0A5J5PQ67
349
A0A0B0MAH0A0A0B0MAH0_GOSARHTH myb-type domain-containing proteinGossypium arboreum (Tree cotton) (Gossypium nanking)29729UniRef100_A0A0B0MAH0
348
A0A5D2EUT6A0A5D2EUT6_GOSDAHTH myb-type domain-containing proteinGossypium darwinii (Darwin's cotton) (Gossypium barbadense var. darwinii)34276UniRef100_A0A5D2EUT6
348
B2ZAT9B2ZAT9_9ROSIPutative MYB transcription factorGossypioides kirkii47615UniRef100_B2ZAT9
348
A0A5D2XK25A0A5D2XK25_GOSMUHTH myb-type domain-containing proteinGossypium mustelinum (Cotton)34275UniRef100_A0A5D2XK25
348
A0A1U8L9L7A0A1U8L9L7_GOSHIuncharacterized protein LOC107925201Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)3635UniRef100_A0A1U8L9L7
348
A0A5J5TZ21A0A5J5TZ21_GOSBAHTH myb-type domain-containing proteinGossypium barbadense (Sea-island cotton) (Egyptian cotton)3634UniRef100_A0A5J5TZ21
348
A0A5D2NN46A0A5D2NN46_GOSTOHTH myb-type domain-containing proteinGossypium tomentosum (Hawaiian cotton) (Gossypium sandvicense)34277UniRef100_A0A5D2NN46
347
A0A0D2RGJ1A0A0D2RGJ1_GOSRAHTH myb-type domain-containing proteinGossypium raimondii (New World cotton)29730UniRef100_A0A0D2RGJ1
323
A0A2P5XPR2A0A2P5XPR2_GOSBAHTH myb-type domain-containing proteinGossypium barbadense (Sea-island cotton) (Egyptian cotton)3634UniRef100_A0A2P5XPR2
320

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A0D2T1Z4

Checksumi: BEE7BA4702CC12FF

FASTA34940,176
        10         20         30         40         50
MIEMHDEEQG EDVCAMPSRS RKCSSFDLND EAGSERDCIG ETSVEEEEIE
60 70 80 90 100
NITEGSSSNN NNGNGNDRRR VRQYVRSKLP RLRWTPDLHY SFVRAVERLG
110 120 130 140 150
GQERATPKLV LQLMNVRGLS IAHVKSHLQM YRSKKLDEAG QVLSQSKRAI
160 170 180 190 200
QGRGEFGSLL CQAITTLSPH HGHQQQHFRM ENGGIVLASE SLDGSNTTFK
210 220 230 240 250
ANFPRHHQFP NSFISKAFGQ ENGFYIQNQI HGTGPIRAMA SRFLEEKRWH
260 270 280 290 300
PFERISNRWK VNGNMYKDMQ SQSHCFWQRP SSDEDKHEPL TKFSSCRTEF
310 320 330 340
EWNQDKVLKD GERLPDLQLR LSQRNGKFDE EKNNHCKGTH EISTQLSLS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again