Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P12270-2 Isoform 2 of Nucleoprotein TPR n=27 Tax=Euteleostomi TaxID=117571 RepID=Isoform 2 of TPR_HUMAN MAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYFEIEKR LSHSQERLVNETRECQSLRLELEKLNNQLKALTEKNKELEIAQDRNIAIQSQFTRTKEEL EAEKRDLIRTNERLSQELEYLTEDVKRLNEKLKESNTTKGELQLKLDELQASDVSVKYRE KRLEQEKELLHSQNTWLNTELKTKTDELLALGREKGNEILELKCNLENKKEEVSRLEEQM NGLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIKLSNLYKSAADDSEAKS NELTRAVEELHKLLKEAGEANKAIQDHLLEVEQSKDQMEKEMLEKIGRLEKELENANDLL SATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVETQDQLLLEKLENKRIN KYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSVKLEQAMKEIQRLQEDTDKANKQSS VLERDNRRMEIQVKDLSQQIRVLLMELEEARGNHVIRDEEVSSADISSSSEVISQHLVSY RNIEELQQQNQRLLVALRELGETREREEQETTSSKITELQLKLESALTELEQLRKSRQHQ MQLVDSIVRQRDMYRILLSQTTGVAIPLHASSLDDVSLASTPKRPSTSQTVSTPAPVPVI ESTEAIEAKAALKQLQEIFENYKKEKAENEKIQNEQLEKLQEQVTDLRSQNTKISTQLDF ASKRYL

Members

List component clusters with 100% or 90% identity.
1 to 25 of 27  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P12270-2Isoform 2 of TPR_HUMAN2Homo sapiens (Human)9606UniRef100_P12270-2
UniRef90_P12270-2
726Representative
Q32P08Q32P08_MOUSETpr protein (Fragment)Mus musculus (Mouse)10090UniRef100_Q32P08
UniRef90_P12270-2
785
A0A5F9C4L2A0A5F9C4L2_RABITTranslocated promoter region, nuclear basket proteinOryctolagus cuniculus (Rabbit)9986UniRef100_A0A5F9C4L2
UniRef90_P12270-2
727
A0A2K5D091A0A2K5D091_AOTNATranslocated promoter region, nuclear basket proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5D091
UniRef90_P12270-2
727
F6XJF9F6XJF9_HORSETranslocated promoter region, nuclear basket proteinEquus caballus (Horse)9796UniRef100_F6XJF9
UniRef90_P12270-2
727
A0A4X1TT23A0A4X1TT23_PIGUncharacterized proteinSus scrofa (Pig)9823UniRef100_A0A4X1TT23
UniRef90_P12270-2
727
A0A2K6NIV8A0A2K6NIV8_RHIROTranslocated promoter region, nuclear basket proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6NIV8
UniRef90_P12270-2
726
F7IAP0F7IAP0_CALJATranslocated promoter region, nuclear basket proteinCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F7IAP0
UniRef90_P12270-2
726
A0A2K6TGT1A0A2K6TGT1_SAIBBTranslocated promoter region, nuclear basket proteinSaimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6TGT1
UniRef90_P12270-2
726
A0A2J8V8A4A0A2J8V8A4_PONABTPR isoform 8Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8V8A4
UniRef90_P12270-2
726
A0A2K5RXF2A0A2K5RXF2_CEBCATranslocated promoter region, nuclear basket proteinCebus capucinus imitator1737458UniRef100_A0A2K5RXF2
UniRef90_P12270-2
726
A0A2K5K9I6A0A2K5K9I6_COLAPTranslocated promoter region, nuclear basket proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5K9I6
UniRef90_P12270-2
726
G3RPN3G3RPN3_GORGOTranslocated promoter region, nuclear basket proteinGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3RPN3
UniRef90_P12270-2
726
A0A2I3TVW9A0A2I3TVW9_PANTRTranslocated promoter region, nuclear basket proteinPan troglodytes (Chimpanzee)9598UniRef100_A0A2I3TVW9
UniRef90_P12270-2
726
A0A5F4C412A0A5F4C412_CANLFTranslocated promoter region, nuclear basket proteinCanis lupus familiaris (Dog) (Canis familiaris)9615UniRef100_A0A5F4C412
UniRef90_P12270-2
724
Q504U6Q504U6_HUMANTPR protein (Fragment)Homo sapiens (Human)9606UniRef100_Q504U6
UniRef90_P12270-2
692
Q58F23Q58F23_HUMANTPR protein (Fragment)Homo sapiens (Human)9606UniRef100_Q58F23
UniRef90_P12270-2
687
A0PJC9A0PJC9_HUMANTPR protein (Fragment)Homo sapiens (Human)9606UniRef100_Q58F23
UniRef90_P12270-2
471
K9KBE5K9KBE5_HORSENucleoprotein TPR-like protein (Fragment)Equus caballus (Horse)9796UniRef100_K9KBE5
UniRef90_Q3TZB5
704
Q3TZB5Q3TZB5_MOUSEUncharacterized protein (Fragment)Mus musculus (Mouse)10090UniRef100_Q3TZB5
UniRef90_Q3TZB5
819Seed
Q05CS8Q05CS8_MOUSETpr protein (Fragment)Mus musculus (Mouse)10090UniRef100_Q05CS8
UniRef90_Q3TZB5
687
A0A0S7IHP7A0A0S7IHP7_9TELETPR (Fragment)Poeciliopsis prolifica (blackstripe livebearer)188132UniRef100_A0A0S7IHP7
UniRef90_A0A0S7IHP7
757
A0A1A8L1K6A0A1A8L1K6_9TELETranslocated promoter region b (To activated MET oncogene) (Fragment)Nothobranchius pienaari704102UniRef100_A0A1A8L1K6
UniRef90_A0A1A8L1K6
718
A4QN67A4QN67_DANRETpr protein (Fragment)Danio rerio (Zebrafish) (Brachydanio rerio)7955UniRef100_A4QN67
UniRef90_A4QN67
696
A0A2I3FRS3A0A2I3FRS3_NOMLETranslocated promoter region, nuclear basket proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3FRS3
UniRef90_A0A2I3FRS3
717

Sequence

Representative sequenceiLengthMass (Da)Tools
P12270-2

Checksumi: E6351C8CC59B6C67

FASTA72683,979
        10         20         30         40         50
MAAVLQQVLE RTELNKLPKS VQNKLEKFLA DQQSEIDGLK GRHEKFKVES
60 70 80 90 100
EQQYFEIEKR LSHSQERLVN ETRECQSLRL ELEKLNNQLK ALTEKNKELE
110 120 130 140 150
IAQDRNIAIQ SQFTRTKEEL EAEKRDLIRT NERLSQELEY LTEDVKRLNE
160 170 180 190 200
KLKESNTTKG ELQLKLDELQ ASDVSVKYRE KRLEQEKELL HSQNTWLNTE
210 220 230 240 250
LKTKTDELLA LGREKGNEIL ELKCNLENKK EEVSRLEEQM NGLKTSNEHL
260 270 280 290 300
QKHVEDLLTK LKEAKEQQAS MEEKFHNELN AHIKLSNLYK SAADDSEAKS
310 320 330 340 350
NELTRAVEEL HKLLKEAGEA NKAIQDHLLE VEQSKDQMEK EMLEKIGRLE
360 370 380 390 400
KELENANDLL SATKRKGAIL SEEELAAMSP TAAAVAKIVK PGMKLTELYN
410 420 430 440 450
AYVETQDQLL LEKLENKRIN KYLDEIVKEV EAKAPILKRQ REEYERAQKA
460 470 480 490 500
VASLSVKLEQ AMKEIQRLQE DTDKANKQSS VLERDNRRME IQVKDLSQQI
510 520 530 540 550
RVLLMELEEA RGNHVIRDEE VSSADISSSS EVISQHLVSY RNIEELQQQN
560 570 580 590 600
QRLLVALREL GETREREEQE TTSSKITELQ LKLESALTEL EQLRKSRQHQ
610 620 630 640 650
MQLVDSIVRQ RDMYRILLSQ TTGVAIPLHA SSLDDVSLAS TPKRPSTSQT
660 670 680 690 700
VSTPAPVPVI ESTEAIEAKA ALKQLQEIFE NYKKEKAENE KIQNEQLEKL
710 720
QEQVTDLRSQ NTKISTQLDF ASKRYL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again