Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_J3MUA0 BHLH domain-containing protein n=3 Tax=Oryza TaxID=4527 RepID=J3MUA0_ORYBR MYGSPVSKDLNLPVQPPMSSSGLLRYRSAPSSLLGEFCDDFLPPAPRAASPDAADNVFSR FLADHQIRDNSGWEESSLMPENISGVKRQRESSEPAQNGGGGLAHQFSLPKTSSEMAAIE KFLQFQDAVPCKIRAKRGCATHPRSIAERVRRTRISERIRKLQELVPNMDKQTNTADMLD LAVDYIKDLQKQVKVLSDSRASCTCSAKRHTEEKLVCQALHKQKGQWSSGIIRIHQSDEG KEEQKEEHREKGPAMGGTIV

Members

List component clusters with 100% or 90% identity.
1 to 3 of 3  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
J3MUA0J3MUA0_ORYBRBHLH domain-containing proteinOryza brachyantha4533UniRef100_J3MUA0
UniRef90_J3MUA0
260Representative
A0A0D3H8B2A0A0D3H8B2_9ORYZBHLH domain-containing proteinOryza barthii65489UniRef100_A0A0D3H8B2
UniRef90_A0A0D3H8B2
264Seed
UPI0007763775transcription factor bHLH130-likeOryza brachyantha4533UniRef100_UPI0007763775
UniRef90_J3MUA0
228

Sequence

Representative sequenceiLengthMass (Da)Tools
J3MUA0

Checksumi: 7030C60306FE5F30

FASTA26028,884
        10         20         30         40         50
MYGSPVSKDL NLPVQPPMSS SGLLRYRSAP SSLLGEFCDD FLPPAPRAAS
60 70 80 90 100
PDAADNVFSR FLADHQIRDN SGWEESSLMP ENISGVKRQR ESSEPAQNGG
110 120 130 140 150
GGLAHQFSLP KTSSEMAAIE KFLQFQDAVP CKIRAKRGCA THPRSIAERV
160 170 180 190 200
RRTRISERIR KLQELVPNMD KQTNTADMLD LAVDYIKDLQ KQVKVLSDSR
210 220 230 240 250
ASCTCSAKRH TEEKLVCQAL HKQKGQWSSG IIRIHQSDEG KEEQKEEHRE
260
KGPAMGGTIV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again