Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_A0A0D2SHE0 CBFD_NFYB_HMF domain-containing protein n=67 Tax=Pentapetalae TaxID=1437201 RepID=A0A0D2SHE0_GOSRA MVDEQERLLPIANVGRIMKQILPPNAKVSKEAKQTLQECATEFISFVTGEASDKCRKENR KTVNGDDICWALGALGFDNYADAIVRYLHKYREIERDKATQNKATCISSQDKDEESSEDR SNQPPHQQAEAPSTRV

Members

List component clusters with 100% or 90% identity.
1 to 25 of 67  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A0D2SHE0A0A0D2SHE0_GOSRACBFD_NFYB_HMF domain-containing proteinGossypium raimondii (New World cotton)29730UniRef100_A0A0D2SHE0
UniRef90_A0A0D2SHE0
136Representative
A0A5D2MMR8A0A5D2MMR8_GOSTOCBFD_NFYB_HMF domain-containing proteinGossypium tomentosum (Hawaiian cotton) (Gossypium sandvicense)34277UniRef100_A0A5D2MMR8
UniRef90_A0A0D2SHE0
136
A0A1U8IBA1A0A1U8IBA1_GOSHInuclear transcription factor Y subunit B-4-likeGossypium hirsutum (Upland cotton) (Gossypium mexicanum)3635UniRef100_A0A5D2MMR8
UniRef90_A0A0D2SHE0
136
A0A5D2WKG2A0A5D2WKG2_GOSMUCBFD_NFYB_HMF domain-containing proteinGossypium mustelinum (Cotton)34275UniRef100_A0A5D2MMR8
UniRef90_A0A0D2SHE0
136
A0A2P5WEI8A0A2P5WEI8_GOSBACBFD_NFYB_HMF domain-containing proteinGossypium barbadense (Sea-island cotton) (Egyptian cotton)3634UniRef100_A0A2P5WEI8
UniRef90_A0A0D2SHE0
136
A0A5D2I093A0A5D2I093_GOSTOCBFD_NFYB_HMF domain-containing proteinGossypium tomentosum (Hawaiian cotton) (Gossypium sandvicense)34277UniRef100_A0A2P5WEI8
UniRef90_A0A0D2SHE0
136
A0A5D2A1D1A0A5D2A1D1_GOSDACBFD_NFYB_HMF domain-containing proteinGossypium darwinii (Darwin's cotton) (Gossypium barbadense var. darwinii)34276UniRef100_A0A2P5WEI8
UniRef90_A0A0D2SHE0
136
A0A1U8I387A0A1U8I387_GOSHInuclear transcription factor Y subunit B-4-likeGossypium hirsutum (Upland cotton) (Gossypium mexicanum)3635UniRef100_A0A1U8I387
UniRef90_A0A0D2SHE0
136
A0A5D2S647A0A5D2S647_GOSMUCBFD_NFYB_HMF domain-containing proteinGossypium mustelinum (Cotton)34275UniRef100_A0A1U8I387
UniRef90_A0A0D2SHE0
136
A0A2P5XJ66A0A2P5XJ66_GOSBACBFD_NFYB_HMF domain-containing proteinGossypium barbadense (Sea-island cotton) (Egyptian cotton)3634UniRef100_A0A2P5XJ66
UniRef90_A0A0D2SHE0
136
A0A5D2E1L6A0A5D2E1L6_GOSDACBFD_NFYB_HMF domain-containing proteinGossypium darwinii (Darwin's cotton) (Gossypium barbadense var. darwinii)34276UniRef100_A0A2P5XJ66
UniRef90_A0A0D2SHE0
136
A0A2R6RAK3A0A2R6RAK3_ACTCCNuclear transcription factor Y subunit B-4 likeActinidia chinensis var. chinensis (Chinese soft-hair kiwi)1590841UniRef100_A0A2R6RAK3
UniRef90_A0A2R6RAK3
140
A0A151U4V5A0A151U4V5_CAJCANuclear transcription factor Y subunit B-4Cajanus cajan (Pigeon pea) (Cajanus indicus)3821UniRef100_A0A151U4V5
UniRef90_A0A151U4V5
142
A0A022QJW4A0A022QJW4_ERYGUCBFD_NFYB_HMF domain-containing proteinErythranthe guttata (Yellow monkey flower) (Mimulus guttatus)4155UniRef100_A0A022QJW4
UniRef90_A0A022QJW4
133
A0A022QI59A0A022QI59_ERYGUCBFD_NFYB_HMF domain-containing proteinErythranthe guttata (Yellow monkey flower) (Mimulus guttatus)4155UniRef100_A0A022QI59
UniRef90_A0A022QI59
125
A0A2C9VD15A0A2C9VD15_MANESCBFD_NFYB_HMF domain-containing proteinManihot esculenta (Cassava) (Jatropha manihot)3983UniRef100_A0A2C9VD15
UniRef90_A0A2C9VD15
141
A0A061F331A0A061F331_THECCNuclear transcription factor Y subunit B-4Theobroma cacao (Cacao) (Cocoa)3641UniRef100_A0A061F331
UniRef90_A0A061F331
144
A0A2I4GPR2A0A2I4GPR2_JUGREnuclear transcription factor Y subunit B-4-likeJuglans regia (English walnut)51240UniRef100_A0A2I4GPR2
UniRef90_A0A2I4GPR2
136
A0A438KBT3A0A438KBT3_VITVINuclear transcription factor Y subunit B-4Vitis vinifera (Grape)29760UniRef100_A0A438KBT3
UniRef90_A0A438KBT3
147
D7U9R6D7U9R6_VITVICBFD_NFYB_HMF domain-containing proteinVitis vinifera (Grape)29760UniRef100_D7U9R6
UniRef90_A0A438KBT3
147
A0A438EZM0A0A438EZM0_VITVINuclear transcription factor Y subunit B-4Vitis vinifera (Grape)29760UniRef100_A0A438EZM0
UniRef90_A0A438KBT3
147
A0A4S4EPR0A0A4S4EPR0_CAMSICBFD_NFYB_HMF domain-containing proteinCamellia sinensis var. sinensis542762UniRef100_A0A4S4EPR0
UniRef90_A0A4S4EPR0
144
A0A2G9IB77A0A2G9IB77_9LAMICCAAT-binding factor, subunit A (HAP3)Handroanthus impetiginosus429701UniRef100_A0A2G9IB77
UniRef90_A0A2G9I2E8
140
A0A2G9I2E8A0A2G9I2E8_9LAMICCAAT-binding factor, subunit A (HAP3)Handroanthus impetiginosus429701UniRef100_A0A2G9I2E8
UniRef90_A0A2G9I2E8
140
A0A2G9I2G5A0A2G9I2G5_9LAMICBFD_NFYB_HMF domain-containing proteinHandroanthus impetiginosus429701UniRef100_A0A2G9I2G5
UniRef90_A0A2G9IB64
139

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A0D2SHE0

Checksumi: 899C346AFA7BCE33

FASTA13615,356
        10         20         30         40         50
MVDEQERLLP IANVGRIMKQ ILPPNAKVSK EAKQTLQECA TEFISFVTGE
60 70 80 90 100
ASDKCRKENR KTVNGDDICW ALGALGFDNY ADAIVRYLHK YREIERDKAT
110 120 130
QNKATCISSQ DKDEESSEDR SNQPPHQQAE APSTRV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again