Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q9HTE9 Serine hydroxymethyltransferase 1 n=18 Tax=Pseudomonas aeruginosa TaxID=287 RepID=GLYA1_PSEAE MFSKHDQIRGYDDELLAAMDAEEARQEDHLELIASENYTSKRVMQAQGSGLTNKYAEGYP GKRYYGGCEHVDKVERLAIDRARQLFGADYANVQPHSGSSANAAVYLALLNAGDTILGMS LAHGGHLTHGAKVSSSGKLYNAVQYGLDTATGLIDYDEVERLAVEHKPKMIVAGFSAYSK TLDFPRFRAIADKVGALLFVDMAHVAGLVAAGLYPNPIPFADVVTTTTHKTLRGPRGGLI LARANEEIEKKLNSAVFPGAQGGPLMHVIAAKAVCFKEALEPGFKDYQAQVIRNAKAMAE VFIGRGYDVVSGGTDNHLMLISLVRQGLTGKEADAALGRVGITVNKNAVPNDPQSPFVTS GIRIGTPAITTRGLQEAQSRELAGWICDILDHLGDADVEAKVATQVAGLCADFPVYR

Members

Expand cluster to 90% or 50% identity.
1 to 18 of 18  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9HTE9GLYA1_PSEAESerine hydroxymethyltransferase 1Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)208964417Representative & Seed
UPI00128FEDB3aminotransferase class I/II-fold pyridoxal phosphate-dependent enzymePseudomonas aeruginosa287367
UPI00106800F9serine hydroxymethyltransferasePseudomonas aeruginosa287309
UPI00129005A0aminotransferase class I/II-fold pyridoxal phosphate-dependent enzymePseudomonas aeruginosa287363
UPI0002120522serine hydroxymethyltransferasePseudomonas aeruginosa287302
UPI0012926FFCaminotransferase class I/II-fold pyridoxal phosphate-dependent enzymePseudomonas aeruginosa287344
UPI0009358BCEserine hydroxymethyltransferasePseudomonas aeruginosa287360
UPI0004454181serine hydroxymethyltransferasePseudomonas aeruginosa287340
UPI000B9C5180serine hydroxymethyltransferasePseudomonas aeruginosa287333
UPI00053DA148serine hydroxymethyltransferasePseudomonas aeruginosa287327
UPI000FF32D76serine hydroxymethyltransferasePseudomonas aeruginosa287321
UPI001068B058serine hydroxymethyltransferasePseudomonas aeruginosa287312
UPI001049E07Eserine hydroxymethyltransferasePseudomonas aeruginosa287368
UPI000FD2434Eserine hydroxymethyltransferasePseudomonas aeruginosa287303
UPI000446DB5Fserine hydroxymethyltransferasePseudomonas aeruginosa287320
UPI00071BC715serine hydroxymethyltransferasePseudomonas aeruginosa287336
UPI00053DEBF3serine hydroxymethyltransferasePseudomonas aeruginosa287313
UPI0010684D64serine hydroxymethyltransferasePseudomonas aeruginosa287317

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9HTE9

Checksumi: 9FDD4C6B7096B9D3

FASTA41744,700
        10         20         30         40         50
MFSKHDQIRG YDDELLAAMD AEEARQEDHL ELIASENYTS KRVMQAQGSG
60 70 80 90 100
LTNKYAEGYP GKRYYGGCEH VDKVERLAID RARQLFGADY ANVQPHSGSS
110 120 130 140 150
ANAAVYLALL NAGDTILGMS LAHGGHLTHG AKVSSSGKLY NAVQYGLDTA
160 170 180 190 200
TGLIDYDEVE RLAVEHKPKM IVAGFSAYSK TLDFPRFRAI ADKVGALLFV
210 220 230 240 250
DMAHVAGLVA AGLYPNPIPF ADVVTTTTHK TLRGPRGGLI LARANEEIEK
260 270 280 290 300
KLNSAVFPGA QGGPLMHVIA AKAVCFKEAL EPGFKDYQAQ VIRNAKAMAE
310 320 330 340 350
VFIGRGYDVV SGGTDNHLML ISLVRQGLTG KEADAALGRV GITVNKNAVP
360 370 380 390 400
NDPQSPFVTS GIRIGTPAIT TRGLQEAQSR ELAGWICDIL DHLGDADVEA
410
KVATQVAGLC ADFPVYR
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again