Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q4UKA4 UPF0335 protein RF_1180 n=26 Tax=Rickettsia TaxID=780 RepID=Y1180_RICFE MSEVVVKEQLEQYISKIERLEQEKADLSQEVKDIFQDASSHGFDVKAMKSILKLKKLDKD KLAEQDAMLELYRDTLGI

Members

Expand cluster to 90% or 50% identity.
1 to 25 of 26  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q4UKA4Y1180_RICFEUPF0335 protein RF_1180Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) (Rickettsia azadi)31545678Representative & Seed
C3PME9Y142_RICAEUPF0335 protein RAF_ORF0142Rickettsia africae (strain ESF-5)34725578
Q92JB4Y153_RICCNUPF0335 protein RC0153Rickettsia conorii (strain ATCC VR-613 / Malish 7)27294478
A8F0L8Y160_RICM5UPF0335 protein RMA_0160Rickettsia massiliae (strain Mtu5)41627678
C4K1R7Y4100_RICPUUPF0335 protein RPR_04100Rickettsia peacockii (strain Rustic)56201978
A0A067AMY0A0A067AMY0_9RICKUPF0335 protein REISMN_00815Rickettsia buchneri146293878
A0A126E8S5A0A126E8S5_9RICKUPF0335 protein UQ52_00875Rickettsia raoultii36982278
G4KM31G4KM31_RICJYUPF0335 protein RJP_0116Rickettsia japonica (strain ATCC VR-1363 / YH)65262078
A0A0B7J3S7A0A0B7J3S7_9RICKUPF0335 protein RMONA_02850Rickettsia monacensis10923278
C4YWN9C4YWN9_9RICKUPF0335 protein REIS_1899Rickettsia endosymbiont of Ixodes scapularis44461278
A0A0F3PFE8A0A0F3PFE8_RICRHUPF0335 protein RMAECT_0539Rickettsia rhipicephali str. Ect135919978
H8K446H8K446_RICAGUPF0335 protein MCE_01395Rickettsia amblyommatis (strain GAT-30V) (Rickettsia amblyommii)110511178
A0A3B7DGT7A0A3B7DGT7_RICJAUPF0335 protein D0Z68_00965Rickettsia japonica3579078
A0A0F3QNK1A0A0F3QNK1_RICPAUPF0335 protein RPAGB_1491Rickettsia parkeri str. Grand Bay135920378
A0A0F3RBK9A0A0F3RBK9_9RICKUPF0335 protein REIP_1683Rickettsia endosymbiont of Ixodes pacificus113332978
A0A0F3R1N6A0A0F3R1N6_RICAMUPF0335 protein RAMDARK_0309Rickettsia amblyommatis str. Darkwater135916678
A0A510G6H7A0A510G6H7_9RICKUPF0335 protein RAS_00950Rickettsia asiatica23880078
A0A0F3MT17A0A0F3MT17_RICFIUPF0335 protein RFEPED_1209Rickettsia felis str. Pedreira135919678
G0GWT4G0GWT4_RICH0UPF0335 protein Rh054_00915Rickettsia heilongjiangensis (strain ATCC VR-1524 / 054)103284578
A0A0S2CAK5A0A0S2CAK5_RICRHUPF0335 protein ASQ44_06845Rickettsia rhipicephali3399278
H6QKU9H6QKU9_RICMAUPF0335 protein RMB_00905Rickettsia massiliae str. AZT80110511278
Q7PAQ4Q7PAQ4_RICS2UPF0335 protein rsib_orf557Rickettsia sibirica (strain ATCC VR-151 / 246)27295178
H8KBU9H8KBU9_RICMSUPF0335 protein MCI_04965Rickettsia montanensis (strain OSU 85-930)110511478
A0A0F3N0L1A0A0F3N0L1_RICAMUPF0335 protein APHACPA_0542Rickettsia amblyommatis str. Ac/Pa135916478
A0A0F3RG44A0A0F3RG44_9RICKUPF0335 protein RAT170B_0045Rickettsia argasii T170-B126883778

Sequence

Representative sequenceiLengthMass (Da)Tools
Q4UKA4

Checksumi: 92169A898D4E8890

FASTA789,029
        10         20         30         40         50
MSEVVVKEQL EQYISKIERL EQEKADLSQE VKDIFQDASS HGFDVKAMKS
60 70
ILKLKKLDKD KLAEQDAMLE LYRDTLGI
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again