Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dual specificity protein phosphatase lip-1

Gene

lip-1

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Dephosphorylates MAP kinase mpk-1.4 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei271Phosphocysteine intermediateBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protein phosphatase
Biological processCell cycle, Cell division, Differentiation, Meiosis, Mitosis, Oogenesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Dual specificity protein phosphatase lip-1Curated (EC:3.1.3.161 Publication, EC:3.1.3.481 Publication)
Alternative name(s):
Lateral signaling-induced phosphatase 1Imported
Mitogen-activated protein kinase phosphatase lip-1Curated
Short name:
MAP kinase phosphatase lip-1By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:lip-1Imported
ORF Names:C05B10.1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegansImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome IV

Organism-specific databases

WormBase

More...
WormBasei
C05B10.1a ; CE31151 ; WBGene00003043 ; lip-1
C05B10.1b ; CE49310 ; WBGene00003043 ; lip-1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Pachytene exit and oocyte development are accelerated (PubMed:12169634, PubMed:21901106). These are associated with the accumulation of smaller oocytes in the proximal gonadal arm, the misalignment of oocytes in multiple rows, a premature nucleolus breakdown and an abnormal mpk-1 phosphorylation after pachytene exit and in diakinesis oocytes (PubMed:12169634, PubMed:21901106). 53 percent of mutants have endomitotic oocytes (PubMed:12169634). Embryo development is arrested before morphogenesis resulting in 50 percent embryonic lethality (PubMed:12169634). In adults, but not in larvae, reduced number of germ cells in the mitotic region of the gonad (PubMed:16319922). Moderate increase in the number of apoptotic corpses in the germline which is further enhanced following gamma irradiation (PubMed:21901106). Increased egl-1 mRNA expression in response to gamma irradiation (PubMed:21901106). Increased cep-1 expression in early pachytene germ cells (PubMed:21901106). Increased life span (PubMed:20624915). Increased MAP kinase activity (PubMed:11161219). Reduced levels of mpk-1 isoform b associated with an increase in mpk-1 isoform b phosphorylation (PubMed:21901106). In lip-1 and let-23, lip-1 and sem-5, and lip-1 and mpk-1 double mutants, normal vulva induction is restored (PubMed:11161219). In lip-1 and mpk-1 double mutants, normal oocyte development and fertility are restored (PubMed:12169634). lip-1 and puf-8 double mutant produces only sperm and has abnormal mpk-1 phosphorylation in the transition zone at the permissive temperature of 20 degrees Celsius. At the restrictive temperature of 25 degrees Celsius, has proximal germline tumors with high levels of mpk-1 phosphorylation (PubMed:22820175).6 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi59 – 60RR → AA: Loss of MAPK1/3 dephosphorylation. 1 Publication2
Mutagenesisi310P → L in zh32; at the restrictive temperature of 25 degrees Celsius, 87 percent of mutants have endomitotic oocytes. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004424941 – 381Dual specificity protein phosphatase lip-1CuratedAdd BLAST381

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
V6CIV8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in vulva cell precursors. Expression is increased in P5.p and P7.p and their descendants during vulva induction. Expressed in syncytium hyp7 (PubMed:11161219). Expressed in germline cells (PubMed:12169634, PubMed:16319922).3 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed at low level in the proximal mitotic region and transition zone of germline cells and at the pachytene stage of meiotic prophase I.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00003043 Expressed in 3 organ(s), highest expression level in adult organism

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
V6CIV8, 1 interactor

STRING: functional protein association networks

More...
STRINGi
6239.C05B10.1

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
V6CIV8

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
V6CIV8

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini184 – 326Tyrosine-protein phosphataseSequence analysisAdd BLAST143

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni56 – 68KIM1 PublicationAdd BLAST13

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The KIM (kinase interacting motif) region may be involved in the binding to MAP kinases.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1717 Eukaryota
COG2453 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000169406

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000114628

KEGG Orthology (KO)

More...
KOi
K04459

Identification of Orthologs from Complete Genome Data

More...
OMAi
TICLAYI

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0249

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00127 DSPc, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.90.190.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR020417 Atypical_DUSP
IPR000340 Dual-sp_phosphatase_cat-dom
IPR024950 DUSP
IPR008343 MKP
IPR029021 Prot-tyrosine_phosphatase-like
IPR000387 TYR_PHOSPHATASE_dom
IPR020422 TYR_PHOSPHATASE_DUAL_dom

The PANTHER Classification System

More...
PANTHERi
PTHR10159 PTHR10159, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00782 DSPc, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01908 ADSPHPHTASE
PR01764 MAPKPHPHTASE

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00195 DSPc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52799 SSF52799, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50056 TYR_PHOSPHATASE_2, 1 hit
PS50054 TYR_PHOSPHATASE_DUAL, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform bImported (identifier: V6CIV8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTTHLPSTSQ NGEEISAEQF NRIFHERNVI VLDCRSNGDS VKRANRFFCS
60 70 80 90 100
LRLPALLQRR LMGGSMRLST VPDLKDLNNS PDQCPEVLLI PGDSEQDEQL
110 120 130 140 150
SAALARNLKS NHYRHFVLGE PVKTLLSQFP TLRDAADENW NTTFQMNSMP
160 170 180 190 200
GQASGQQASS GPLLNLNQLR LEGEDQGGKQ RAEFPVKLTN FLYLGNAETA
210 220 230 240 250
KNRDVLKKYS ISHVINVTSN LPNTFEEDPN MRYLRISADD NASHNLTKFF
260 270 280 290 300
PEAISFIDDA RRNDSACLVH CLAGISRSVT ICLAYLMKTE MCTLDSAYEW
310 320 330 340 350
VQKRNASIAP NFHFMGQLTD YEKMLGLNSN RVGTYPSSAP RSPSCAIEAA
360 370 380
AVSQVGGLLT PPPTSCSASP QSSNHSAKSF H
Note: No experimental confirmation available.Curated
Length:381
Mass (Da):42,174
Last modified:February 19, 2014 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC6AB1FBC4A2C47C5
GO
Isoform aImported (identifier: V6CIV8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     334-369: TYPSSAPRSPSCAIEAAAVSQVGGLLTPPPTSCSAS → VSRQAVNFDVHFFCIFKLKKKEENSPESRILAETAV
     370-381: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:369
Mass (Da):41,586
Checksum:i5A13DEA9C5198A17
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_059250334 – 369TYPSS…SCSAS → VSRQAVNFDVHFFCIFKLKK KEENSPESRILAETAV in isoform a. CuratedAdd BLAST36
Alternative sequenceiVSP_059251370 – 381Missing in isoform a. CuratedAdd BLAST12

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
BX284604 Genomic DNA Translation: CCD63076.1
BX284604 Genomic DNA Translation: CDK13377.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T32494

NCBI Reference Sequences

More...
RefSeqi
NP_001293707.1, NM_001306778.1 [V6CIV8-1]
NP_501053.2, NM_068652.2 [V6CIV8-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Cel.20225

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
C05B10.1a; C05B10.1a; WBGene00003043 [V6CIV8-2]
C05B10.1b; C05B10.1b; WBGene00003043 [V6CIV8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
191704

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
cel:CELE_C05B10.1

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BX284604 Genomic DNA Translation: CCD63076.1
BX284604 Genomic DNA Translation: CDK13377.1
PIRiT32494
RefSeqiNP_001293707.1, NM_001306778.1 [V6CIV8-1]
NP_501053.2, NM_068652.2 [V6CIV8-2]
UniGeneiCel.20225

3D structure databases

ProteinModelPortaliV6CIV8
SMRiV6CIV8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiV6CIV8, 1 interactor
STRINGi6239.C05B10.1

Proteomic databases

EPDiV6CIV8

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiC05B10.1a; C05B10.1a; WBGene00003043 [V6CIV8-2]
C05B10.1b; C05B10.1b; WBGene00003043 [V6CIV8-1]
GeneIDi191704
KEGGicel:CELE_C05B10.1

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
191704
WormBaseiC05B10.1a ; CE31151 ; WBGene00003043 ; lip-1
C05B10.1b ; CE49310 ; WBGene00003043 ; lip-1

Phylogenomic databases

eggNOGiKOG1717 Eukaryota
COG2453 LUCA
GeneTreeiENSGT00940000169406
HOGENOMiHOG000114628
KOiK04459
OMAiTICLAYI
OrthoDBiEOG091G0249

Miscellaneous databases

Protein Ontology

More...
PROi
PR:V6CIV8

Gene expression databases

BgeeiWBGene00003043 Expressed in 3 organ(s), highest expression level in adult organism

Family and domain databases

CDDicd00127 DSPc, 1 hit
Gene3Di3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR020417 Atypical_DUSP
IPR000340 Dual-sp_phosphatase_cat-dom
IPR024950 DUSP
IPR008343 MKP
IPR029021 Prot-tyrosine_phosphatase-like
IPR000387 TYR_PHOSPHATASE_dom
IPR020422 TYR_PHOSPHATASE_DUAL_dom
PANTHERiPTHR10159 PTHR10159, 1 hit
PfamiView protein in Pfam
PF00782 DSPc, 1 hit
PRINTSiPR01908 ADSPHPHTASE
PR01764 MAPKPHPHTASE
SMARTiView protein in SMART
SM00195 DSPc, 1 hit
SUPFAMiSSF52799 SSF52799, 1 hit
PROSITEiView protein in PROSITE
PS50056 TYR_PHOSPHATASE_2, 1 hit
PS50054 TYR_PHOSPHATASE_DUAL, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDUSL_CAEEL
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: V6CIV8
Secondary accession number(s): O44128
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 20, 2017
Last sequence update: February 19, 2014
Last modified: December 5, 2018
This is version 45 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again