Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9ZWG1 (PUMP2_ARATH)

Entry version 135 (02 Dec 2020)
Sequence version 1 (01 May 1999)
Previous versions | rss
Add a publicationFeedback
Protein

Mitochondrial uncoupling protein 2

Gene

PUMP2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

PUMPS are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation. This leads to a decrease in the efficiency of oxidative phosphorylation and an increase in heat production. May be involved in protecting plant cells against oxidative stress damage (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processStress response, Transport

Protein family/group databases

Transport Classification Database

More...TCDBi		2.A.29.3.8, the mitochondrial carrier (mc) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Mitochondrial uncoupling protein 2
Short name:
AtPUMP2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PUMP2
Synonyms:UCP2
Ordered Locus Names:At5g58970
ORF Names:K19M22.16
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliopsida › eudicotyledons › Gunneridae › Pentapetalae › rosids › malvids › Brassicales › Brassicaceae › Camelineae › Arabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Arabidopsis Information Portal

More...Araporti		AT5G58970

The Arabidopsis Information Resource

More...TAIRi		locus:2154593, AT5G58970

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei16 – 36Helical; Name=1Sequence analysisAdd BLAST21
Transmembranei73 – 93Helical; Name=2Sequence analysisAdd BLAST21
Transmembranei120 – 140Helical; Name=3Sequence analysisAdd BLAST21
Transmembranei179 – 199Helical; Name=4Sequence analysisAdd BLAST21
Transmembranei220 – 240Helical; Name=5Sequence analysisAdd BLAST21
Transmembranei270 – 290Helical; Name=6Sequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004202561 – 305Mitochondrial uncoupling protein 2Add BLAST305

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9ZWG1

PRoteomics IDEntifications database

More...PRIDEi		Q9ZWG1

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		226124 [Q9ZWG1-1]

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By chloramphenicol.1 Publication

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9ZWG1, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9ZWG1, AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...STRINGi		3702.AT5G58970.1

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9ZWG1

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati10 – 104Solcar 1Add BLAST95
Repeati114 – 205Solcar 2Add BLAST92
Repeati214 – 297Solcar 3Add BLAST84

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the mitochondrial carrier (TC 2.A.29) family. [View classification]Curated

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0753, Eukaryota

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_015166_14_2_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9ZWG1

Identification of Orthologs from Complete Genome Data

More...OMAi		NCAMKMF

Database of Orthologous Groups

More...OrthoDBi		984118at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9ZWG1

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.50.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR002030, Mit_uncoupling_UCP-like
IPR018108, Mitochondrial_sb/sol_carrier
IPR023395, Mt_carrier_dom_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00153, Mito_carr, 3 hits

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00784, MTUNCOUPLING

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF103506, SSF103506, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50920, SOLCAR, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9ZWG1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MADFKPRIEI SFLETFICSA FAACFAELCT IPLDTAKVRL QLQRKIPTGD 
        60         70         80         90        100
GENLPKYRGS IGTLATIARE EGISGLWKGV IAGLHRQCIY GGLRIGLYEP 
       110        120        130        140        150
VKTLLVGSDF IGDIPLYQKI LAALLTGAIA IIVANPTDLV KVRLQSEGKL 
       160        170        180        190        200
PAGVPRRYAG AVDAYFTIVK LEGVSALWTG LGPNIARNAI VNAAELASYD 
       210        220        230        240        250
QIKETIMKIP FFRDSVLTHL LAGLAAGFFA VCIGSPIDVV KSRMMGDSTY 
       260        270        280        290        300
RNTVDCFIKT MKTEGIMAFY KGFLPNFTRL GTWNAIMFLT LEQVKKVFLR 

EVLYD
Length:305
Mass (Da):33,442
Last modified:May 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB0F6428F758EDCD7
GO
Isoform 2 (identifier: Q9ZWG1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     241-272: KSRMMGDSTYRNTVDCFIKTMKTEGIMAFYKG → SIHFRLLHKSTTRLFGFRLIMCGSAYIYNKFQ
     273-305: Missing.

Show »
Length:272
Mass (Da):29,595
Checksum:iFF052F5EB4C1F628
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q9FGU9Q9FGU9_ARATH
Gb|AAC95187.1
At5g59020, K19M22.16, K19M22_16
780Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_044433241 – 272KSRMM…AFYKG → SIHFRLLHKSTTRLFGFRLI MCGSAYIYNKFQ in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_044434273 – 305Missing in isoform 2. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB021706 mRNA Translation: BAA36222.1
JQ937241 mRNA Translation: AFI41209.1
AB016885 Genomic DNA Translation: BAB09640.1
CP002688 Genomic DNA Translation: AED97124.1
CP002688 Genomic DNA Translation: AED97125.1
AY088200 mRNA Translation: AAM65742.1
BX831274 mRNA No translation available.

NCBI Reference Sequences

More...RefSeqi		NP_568894.1, NM_125287.5 [Q9ZWG1-1]
NP_974962.1, NM_203233.1 [Q9ZWG1-2]

Genome annotation databases

Ensembl plant genome annotation project

More...EnsemblPlantsi		AT5G58970.1; AT5G58970.1; AT5G58970 [Q9ZWG1-1]
AT5G58970.2; AT5G58970.2; AT5G58970 [Q9ZWG1-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		836014

Gramene; a comparative resource for plants

More...Gramenei		AT5G58970.1; AT5G58970.1; AT5G58970 [Q9ZWG1-1]
AT5G58970.2; AT5G58970.2; AT5G58970 [Q9ZWG1-2]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		ath:AT5G58970

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB021706 mRNA Translation: BAA36222.1
JQ937241 mRNA Translation: AFI41209.1
AB016885 Genomic DNA Translation: BAB09640.1
CP002688 Genomic DNA Translation: AED97124.1
CP002688 Genomic DNA Translation: AED97125.1
AY088200 mRNA Translation: AAM65742.1
BX831274 mRNA No translation available.
RefSeqiNP_568894.1, NM_125287.5 [Q9ZWG1-1]
NP_974962.1, NM_203233.1 [Q9ZWG1-2]

3D structure databases

SMRiQ9ZWG1
ModBaseiSearch...

Protein-protein interaction databases

STRINGi3702.AT5G58970.1

Protein family/group databases

TCDBi2.A.29.3.8, the mitochondrial carrier (mc) family

Proteomic databases

PaxDbiQ9ZWG1
PRIDEiQ9ZWG1
ProteomicsDBi226124 [Q9ZWG1-1]

Genome annotation databases

EnsemblPlantsiAT5G58970.1; AT5G58970.1; AT5G58970 [Q9ZWG1-1]
AT5G58970.2; AT5G58970.2; AT5G58970 [Q9ZWG1-2]
GeneIDi836014
GrameneiAT5G58970.1; AT5G58970.1; AT5G58970 [Q9ZWG1-1]
AT5G58970.2; AT5G58970.2; AT5G58970 [Q9ZWG1-2]
KEGGiath:AT5G58970

Organism-specific databases

AraportiAT5G58970
TAIRilocus:2154593, AT5G58970

Phylogenomic databases

eggNOGiKOG0753, Eukaryota
HOGENOMiCLU_015166_14_2_1
InParanoidiQ9ZWG1
OMAiNCAMKMF
OrthoDBi984118at2759
PhylomeDBiQ9ZWG1

Miscellaneous databases

Protein Ontology

More...PROi		PR:Q9ZWG1

Gene expression databases

ExpressionAtlasiQ9ZWG1, baseline and differential
GenevisibleiQ9ZWG1, AT

Family and domain databases

Gene3Di1.50.40.10, 1 hit
InterProiView protein in InterPro
IPR002030, Mit_uncoupling_UCP-like
IPR018108, Mitochondrial_sb/sol_carrier
IPR023395, Mt_carrier_dom_sf
PfamiView protein in Pfam
PF00153, Mito_carr, 3 hits
PRINTSiPR00784, MTUNCOUPLING
SUPFAMiSSF103506, SSF103506, 1 hit
PROSITEiView protein in PROSITE
PS50920, SOLCAR, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPUMP2_ARATH
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9ZWG1
Secondary accession number(s): F4KGF2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2012
Last sequence update: May 1, 1999
Last modified: December 2, 2020
This is version 135 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again