Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 141 (29 Sep 2021)
Sequence version 1 (01 May 1999)
Previous versions | rss
Add a publicationFeedback
Protein

Probable inositol transporter 3

Gene

INT3

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plasma membrane inositol-proton symporter.

By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processSymport, Transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Probable inositol transporter 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:INT3
Ordered Locus Names:At2g35740
ORF Names:T20F21.7
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT2G35740

The Arabidopsis Information Resource

More...
TAIRi
locus:2058774, AT2G35740

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei34 – 54Helical; Name=1Sequence analysisAdd BLAST21
Transmembranei69 – 89Helical; Name=2Sequence analysisAdd BLAST21
Transmembranei104 – 124Helical; Name=3Sequence analysisAdd BLAST21
Transmembranei127 – 147Helical; Name=4Sequence analysisAdd BLAST21
Transmembranei161 – 181Helical; Name=5Sequence analysisAdd BLAST21
Transmembranei187 – 207Helical; Name=6Sequence analysisAdd BLAST21
Transmembranei289 – 309Helical; Name=7Sequence analysisAdd BLAST21
Transmembranei316 – 336Helical; Name=8Sequence analysisAdd BLAST21
Transmembranei344 – 364Helical; Name=9Sequence analysisAdd BLAST21
Transmembranei455 – 475Helical; Name=10Sequence analysisAdd BLAST21
Transmembranei493 – 513Helical; Name=11Sequence analysisAdd BLAST21
Transmembranei524 – 544Helical; Name=12Sequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002598771 – 580Probable inositol transporter 3Add BLAST580

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9ZQP6

PRoteomics IDEntifications database

More...
PRIDEi
Q9ZQP6

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
248467 [Q9ZQP6-1]

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9ZQP6, differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9ZQP6, AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
3702.AT2G35740.1

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0254, Eukaryota

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001265_30_5_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9ZQP6

Identification of Orthologs from Complete Genome Data

More...
OMAi
MLQVYFC

Database of Orthologous Groups

More...
OrthoDBi
326501at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9ZQP6

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.1250.20, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR020846, MFS_dom
IPR005828, MFS_sugar_transport-like
IPR036259, MFS_trans_sf
IPR003663, Sugar/inositol_transpt
IPR005829, Sugar_transporter_CS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00083, Sugar_tr, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00171, SUGRTRNSPORT

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF103473, SSF103473, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00879, SP, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50850, MFS, 1 hit
PS00216, SUGAR_TRANSPORT_1, 1 hit
PS00217, SUGAR_TRANSPORT_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9ZQP6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVEEASKSEQ INITEVWTTT WETPYIMRLA LSAGIGGLLF GYNTGVIAGA
60 70 80 90 100
LLYIKEEFGE VDNKTWLQEI IVSMTVAGAI VGAAIGGWYN DKFGRRMSVL
110 120 130 140 150
IADVLFLLGA LVMVIAHAPW VIILGRLLVG FGVGMASMTS PLYISEMSPA
160 170 180 190 200
RIRGALVSTN GLLITGGQFL SYLINLAFVH TPGTWRWMLG VSAIPAIIQF
210 220 230 240 250
CLMLTLPESP RWLYRNDRKA ESRDILERIY PAEMVEAEIA ALKESVRAET
260 270 280 290 300
ADEDIIGHTF SDKLRGALSN PVVRHGLAAG ITVQVAQQFV GINTVMYYSP
310 320 330 340 350
TILQFAGYAS NKTAMALALI TSGLNAVGSV VSMMFVDRYG RRKLMIISMF
360 370 380 390 400
GIITCLVILA AVFNEASNHA PKIDKRDSRN FAKNATCPAF APFTASRSPP
410 420 430 440 450
SNWNCMKCLQ YDCGFCSNGA QEYAPGACIV QSADMKALCH SKGRTFFKDG
460 470 480 490 500
CPSKFGYLAI VFLGLYIIVY APGMGTVPWI VNSEIYPLRY RGLAGGIAAV
510 520 530 540 550
SNWMSNLVVS ETFLTLTNAV GSSGTFLLFA GSSAVGLFFI WLLVPETKGL
560 570 580
QFEEVEKLLE GGFRPSLLRP TTKENQVETP
Length:580
Mass (Da):63,172
Last modified:May 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFC6437FD5A3E00B3
GO
Isoform 2 (identifier: Q9ZQP6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     149-182: PARIRGALVSTNGLLITGGQFLSYLINLAFVHTP → HTGYMEVDVGSLGDSSDHSVLPHANAARVSTVAL
     183-580: Missing.

Note: Major isoform, probably not functional. May be due to competing donor splice site.Curated
Show »
Length:182
Mass (Da):19,496
Checksum:iC7D2F1DC0CA65A96
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_043682149 – 182PARIR…FVHTP → HTGYMEVDVGSLGDSSDHSV LPHANAARVSTVAL in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_043683183 – 580Missing in isoform 2. 1 PublicationAdd BLAST398

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ973177 mRNA Translation: CAJ00305.1
AM778029 mRNA Translation: CAO82752.1
AC006068 Genomic DNA Translation: AAD15441.1
CP002685 Genomic DNA Translation: AEC09155.1

Protein sequence database of the Protein Information Resource

More...
PIRi
D84772

NCBI Reference Sequences

More...
RefSeqi
NP_181117.1, NM_129132.2 [Q9ZQP6-1]

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT2G35740.1; AT2G35740.1; AT2G35740 [Q9ZQP6-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
818146

Gramene; a comparative resource for plants

More...
Gramenei
AT2G35740.1; AT2G35740.1; AT2G35740 [Q9ZQP6-1]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT2G35740

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ973177 mRNA Translation: CAJ00305.1
AM778029 mRNA Translation: CAO82752.1
AC006068 Genomic DNA Translation: AAD15441.1
CP002685 Genomic DNA Translation: AEC09155.1
PIRiD84772
RefSeqiNP_181117.1, NM_129132.2 [Q9ZQP6-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi3702.AT2G35740.1

Proteomic databases

PaxDbiQ9ZQP6
PRIDEiQ9ZQP6
ProteomicsDBi248467 [Q9ZQP6-1]

Genome annotation databases

EnsemblPlantsiAT2G35740.1; AT2G35740.1; AT2G35740 [Q9ZQP6-1]
GeneIDi818146
GrameneiAT2G35740.1; AT2G35740.1; AT2G35740 [Q9ZQP6-1]
KEGGiath:AT2G35740

Organism-specific databases

AraportiAT2G35740
TAIRilocus:2058774, AT2G35740

Phylogenomic databases

eggNOGiKOG0254, Eukaryota
HOGENOMiCLU_001265_30_5_1
InParanoidiQ9ZQP6
OMAiMLQVYFC
OrthoDBi326501at2759
PhylomeDBiQ9ZQP6

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9ZQP6

Gene expression databases

ExpressionAtlasiQ9ZQP6, differential
GenevisibleiQ9ZQP6, AT

Family and domain databases

Gene3Di1.20.1250.20, 2 hits
InterProiView protein in InterPro
IPR020846, MFS_dom
IPR005828, MFS_sugar_transport-like
IPR036259, MFS_trans_sf
IPR003663, Sugar/inositol_transpt
IPR005829, Sugar_transporter_CS
PfamiView protein in Pfam
PF00083, Sugar_tr, 2 hits
PRINTSiPR00171, SUGRTRNSPORT
SUPFAMiSSF103473, SSF103473, 1 hit
TIGRFAMsiTIGR00879, SP, 1 hit
PROSITEiView protein in PROSITE
PS50850, MFS, 1 hit
PS00216, SUGAR_TRANSPORT_1, 1 hit
PS00217, SUGAR_TRANSPORT_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiINT3_ARATH
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9ZQP6
Secondary accession number(s): A9JNR7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: May 1, 1999
Last modified: September 29, 2021
This is version 141 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again