Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - Q9Z351 (KCNQ2_MOUSE)

Entry version 177 (25 May 2022)
Sequence version 1 (01 May 1999)
Previous versions | rss
Add a publicationFeedback
Protein

Potassium voltage-gated channel subfamily KQT member 2

Gene

Kcnq2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Associates with KCNQ3 to form a potassium channel with essentially identical properties to the channel underlying the native M-current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons as well as the responsiveness to synaptic inputs. Therefore, it is important in the regulation of neuronal excitability.

1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • ankyrin binding Source: MGI
  • calmodulin binding Source: MGI
  • delayed rectifier potassium channel activity Source: GO_Central
  • protein N-terminus binding Source: MGI
  • voltage-gated ion channel activity Source: MGI
  • voltage-gated potassium channel activity Source: UniProtKB
Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel, Potassium channel, Voltage-gated channel
Biological processIon transport, Potassium transport, Transport
LigandPotassium

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-1296072, Voltage gated Potassium channels

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Potassium voltage-gated channel subfamily KQT member 2Curated
Alternative name(s):
KQT-like 21 Publication
Potassium channel subunit alpha KvLQT2
Voltage-gated potassium channel subunit Kv7.2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Kcnq2Imported
Synonyms:Kqt21 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:1309503, Kcnq2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 91CytoplasmicSequence analysisAdd BLAST91
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei92 – 112Helical; Name=Segment S1Sequence analysisAdd BLAST21
Topological domaini113 – 122ExtracellularSequence analysis10
Transmembranei123 – 143Helical; Name=Segment S2Sequence analysisAdd BLAST21
Topological domaini144 – 166CytoplasmicSequence analysisAdd BLAST23
Transmembranei167 – 187Helical; Name=Segment S3Sequence analysisAdd BLAST21
Topological domaini188 – 197ExtracellularSequence analysis10
Transmembranei198 – 221Helical; Voltage-sensor; Name=Segment S4Sequence analysisAdd BLAST24
Topological domaini222 – 231CytoplasmicSequence analysis10
Transmembranei232 – 252Helical; Name=Segment S5Sequence analysisAdd BLAST21
Topological domaini253 – 264ExtracellularSequence analysisAdd BLAST12
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei265 – 285Pore-forming; Name=Segment H5Sequence analysisAdd BLAST21
Topological domaini286 – 291ExtracellularSequence analysis6
Transmembranei292 – 312Helical; Name=Segment S6Sequence analysisAdd BLAST21
Topological domaini313 – 759CytoplasmicSequence analysisAdd BLAST447

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice lacking Kcnq2 present no overt phenotype, but die a few hours after birth of pulmonary atelectasis which is not due to the status of epileptic seizures.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi345R → E: Loss of interaction with calmodulin. 1 Publication1
Mutagenesisi525K → E: Loss of interaction with calmodulin; when associated with E-526. 1 Publication1
Mutagenesisi526R → E: Loss of interaction with calmodulin; when associated with E-525. 1 Publication1

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL2985

DrugCentral

More...DrugCentrali		Q9Z351

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000540311 – 759Potassium voltage-gated channel subfamily KQT member 2Add BLAST759

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei52Phosphoserine; by PKABy similarity1
Modified residuei438PhosphoserineCombined sources1
Modified residuei440PhosphoserineCombined sources1
Modified residuei444PhosphoserineCombined sources1
Modified residuei448PhosphoserineCombined sources1
Modified residuei450PhosphoserineCombined sources1
Modified residuei479PhosphoserineBy similarity1
Modified residuei681PhosphoserineBy similarity1
Isoform 13 (identifier: Q9Z351-13)
Modified residuei813PhosphotyrosineCombined sources1
Isoform 12 (identifier: Q9Z351-12)
Modified residuei831PhosphotyrosineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

KCNQ2/KCNQ3 heteromeric current can be increased by intracellular cyclic AMP, an effect that depends on phosphorylation of Ser-52 in the N-terminal region.By similarity
KCNQ2/KCNQ3 are ubiquitinated by NEDD4L. Ubiquitination leads to protein degradation. Degradation induced by NEDD4L is inhibited by USP36.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

PRoteomics IDEntifications database

More...PRIDEi		Q9Z351

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		263404 [Q9Z351-1]
263405 [Q9Z351-2]
263406 [Q9Z351-3]
263407 [Q9Z351-4]
263408 [Q9Z351-5]
263409 [Q9Z351-6]
263410 [Q9Z351-7]
263411 [Q9Z351-8]
263412 [Q9Z351-9]
263413 [Q9Z351-10]
263414 [Q9Z351-11]
263415 [Q9Z351-12]
263416 [Q9Z351-13]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9Z351

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9Z351

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Exclusively expressed in the brain. Expressed in every neuron-containing regions of the central nervous system examined, such as the cerebellum, cerebral cortex, occipital pole, substantia nigra, amygdala, caudate nucleus, hippocampus and thalamus. Also detected in the cochlea.

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Detected at day 11, 15 and 17 of the embryonic development. Expression increases by a factor of 2.5 at 1 week after birth. Then the expression level remains stable until the adult stage. The mRNAs for shorter forms (isoforms 9, 10 and 11) are specifically expressed in an embryo on the 11th day after gestation.

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterotetramer with KCNQ3; form the heterotetrameric M potassium channel (By similarity).

Interacts with calmodulin; the interaction is calcium-independent, constitutive and participates in the proper assembly of a functional heterotetrameric M channel (PubMed:12223552). May associate with KCNE2 (By similarity).

Interacts with IQCJ-SCHIP1 (PubMed:27979964).

By similarity2 Publications

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		200918, 14 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q9Z351

Protein interaction database and analysis system

More...IntActi		Q9Z351, 2 interactors

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000122915

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q9Z351

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9Z351, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		Q9Z351

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9Z351

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni317 – 512Mediates interaction with calmodulinBy similarityAdd BLAST196
Regioni393 – 412DisorderedSequence analysisAdd BLAST20
Regioni419 – 459DisorderedSequence analysisAdd BLAST41
Regioni565 – 628DisorderedSequence analysisAdd BLAST64
Regioni705 – 742DisorderedSequence analysisAdd BLAST38

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi277 – 282Selectivity filterBy similarity6

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi431 – 459Polar residuesSequence analysisAdd BLAST29
Compositional biasi604 – 620Basic and acidic residuesSequence analysisAdd BLAST17
Compositional biasi722 – 737Polar residuesSequence analysisAdd BLAST16

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the potassium channel family. KQT (TC 1.A.1.15) subfamily. Kv7.2/KCNQ2 sub-subfamily. [View classification]Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1419, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9Z351

Database of Orthologous Groups

More...OrthoDBi		1168835at2759

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR005821, Ion_trans_dom
IPR003937, K_chnl_volt-dep_KCNQ
IPR003947, K_chnl_volt-dep_KCNQ2
IPR013821, K_chnl_volt-dep_KCNQ_C
IPR028325, VG_K_chnl

The PANTHER Classification System

More...PANTHERi		PTHR11537, PTHR11537, 1 hit
PTHR11537:SF6, PTHR11537:SF6, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00520, Ion_trans, 1 hit
PF03520, KCNQ_channel, 2 hits

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01461, KCNQ2CHANNEL
PR01459, KCNQCHANNEL

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (13+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 13 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 13 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Z351-1) [UniParc]FASTAAdd to basket
Also known as: MKQT2.1

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVQKSRNGGV YPGTSGEKKL KVGFVGLDPG APDSTRDGAL LIAGSEAPKR 
        60         70         80         90        100
GSVLSKPRTG GAGAGKPPKR NAFYRKLQNF LYNVLERPRG WAFIYHAYVF 
       110        120        130        140        150
LLVFSCLVLS VFSTIKEYEK SSEGALYILE IVTIVVFGVE YFVRIWAAGC 
       160        170        180        190        200
CCRYRGWRGR LKFARKPFCV IDIMVLIASI AVLAAGSQGN VFATSALRSL 
       210        220        230        240        250
RFLQILRMIR MDRRGGTWKL LGSVVYAHSK ELVTAWYIGF LCLILASFLV 
       260        270        280        290        300
YLAEKGENDH FDTYADALWW GLITLTTIGY GDKYPQTWNG RLLAATFTLI 
       310        320        330        340        350
GVSFFALPAG ILGSGFALKV QEQHRPKHFE KRRNPAAGLI QSAWRFYATN 
       360        370        380        390        400
LSRTDLHSTW QYYERTVTVP MYRLIPPLNQ LELLRNLKSK SGLTFRKEPQ 
       410        420        430        440        450
PEPSPSQKVS LKDRVFSSPR GMAAKGKGSP QAQTVRRSPS ADQSLDDSPS 
       460        470        480        490        500
KVPKSWSFGD RSRTRQAFRI KGAASRQNSE EASLPGEDIV EDNKSCNCEF 
       510        520        530        540        550
VTEDLTPGLK VSIRAVCVMR FLVSKRKFKE SLRPYDVMDV IEQYSAGHLD 
       560        570        580        590        600
MLSRIKSLQS RIDMIVGPPP PSTPRDKKYP TKGPTAPSRE SPQYSPRVDH 
       610        620        630        640        650
IVGRGPTITD KDRTKGPAET ELPEDPSMMG RLGKVEKQVL SMEKKLDFLV 
       660        670        680        690        700
SIYTQRMGIP PAETEAYFGA KEPEPAPPYH SPEDSRDHAD KHGCIIKIVR 
       710        720        730        740        750
STSSTGQRNY AAPPAIPPAQ CPPSTSWQQS HQRHGTSPVG DHGSLVLRLE 

RSAGMMSCH
Length:759
Mass (Da):84,450
Last modified:May 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC1D12DBFF3979D3F
GO
Isoform 2 (identifier: Q9Z351-2) [UniParc]FASTAAdd to basket
Also known as: MKQT2.2

The sequence of this isoform differs from the canonical sequence as follows:
     562-596: IDMIVGPPPPSTPRDKKYPTKGPTAPSRESPQYSP → QEPLPVQSGHEQGPPGQNQAWHKGHQGLGD

Show »
Length:754
Mass (Da):83,871
Checksum:iE5B9E1302AD1BA3A
GO
Isoform 3 (identifier: Q9Z351-3) [UniParc]FASTAAdd to basket
Also known as: MKQT2.3

The sequence of this isoform differs from the canonical sequence as follows:
     407-418: Missing.

Show »
Length:747
Mass (Da):83,075
Checksum:i7766068E0E4660FA
GO
Isoform 4 (identifier: Q9Z351-4) [UniParc]FASTAAdd to basket
Also known as: MKQT2.4

The sequence of this isoform differs from the canonical sequence as follows:
     562-597: Missing.

Show »
Length:723
Mass (Da):80,519
Checksum:iB1A8D7BC05B0AAD2
GO
Isoform 5 (identifier: Q9Z351-5) [UniParc]FASTAAdd to basket
Also known as: MKQT2.5

The sequence of this isoform differs from the canonical sequence as follows:
     562-570: IDMIVGPPP → SCDWRGVLA
     571-759: Missing.

Show »
Length:570
Mass (Da):63,805
Checksum:iDB5DA2952C6B6D09
GO
Isoform 6 (identifier: Q9Z351-6) [UniParc]FASTAAdd to basket
Also known as: MKQT2.6

The sequence of this isoform differs from the canonical sequence as follows:
     562-623: IDMIVGPPPP...TKGPAETELP → QEPLPVQSGH...FLLCFHTVCF
     624-759: Missing.

Note: May be due to an intron retention.Curated
Show »
Length:623
Mass (Da):69,734
Checksum:i8D2C7F4729A2BAB8
GO
Isoform 7 (identifier: Q9Z351-7) [UniParc]FASTAAdd to basket
Also known as: MKQT2.7

The sequence of this isoform differs from the canonical sequence as follows:
     372-372: Y → YSSQTQTYGAS
     406-463: SQKVSLKDRV...KSWSFGDRSR → RSVPPASSRP...PGTPRVTSQL
     464-759: Missing.

Note: May be due to an intron retention.Curated
Show »
Length:473
Mass (Da):52,651
Checksum:i3AFED94FA2262127
GO
Isoform 8 (identifier: Q9Z351-8) [UniParc]FASTAAdd to basket
Also known as: MKQT2.8

The sequence of this isoform differs from the canonical sequence as follows:
     406-463: SQKVSLKDRV...KSWSFGDRSR → RSVPPASSRP...PGTPRVTSQL
     464-759: Missing.

Note: May be due to an intron retention.Curated
Show »
Length:463
Mass (Da):51,640
Checksum:i9E6F79DFE373028A
GO
Isoform 9 (identifier: Q9Z351-9) [UniParc]FASTAAdd to basket
Also known as: MKQT2.9

The sequence of this isoform differs from the canonical sequence as follows:
     342-349: SAWRFYAT → GQVRCAGH
     350-759: Missing.

Note: May be due to an intron retention.Curated
Show »
Length:349
Mass (Da):38,652
Checksum:i034B50C777C54EC3
GO
Isoform 10 (identifier: Q9Z351-10) [UniParc]FASTAAdd to basket
Also known as: MKQT2.10

The sequence of this isoform differs from the canonical sequence as follows:
     342-347: SAWRFY → VSLSPC
     348-759: Missing.

Note: May be due to an intron retention.Curated
Show »
Length:347
Mass (Da):38,430
Checksum:i93BEA660ADB9FA73
GO
Isoform 11 (identifier: Q9Z351-11) [UniParc]FASTAAdd to basket
Also known as: MKQT2.11

The sequence of this isoform differs from the canonical sequence as follows:
     310-338: GILGSGFALKVQEQHRPKHFEKRRNPAAG → VSPAHLPTLEMLGVLEAPHKAWPWPTCEL
     339-759: Missing.

Note: May be due to an intron retention.Curated
Show »
Length:338
Mass (Da):37,483
Checksum:i82520B7C1C01FA2F
GO
Isoform 12 (identifier: Q9Z351-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     372-372: Y → YSSQTQTYGAS
     406-406: S → SKGRPCRGCLCGCCPGHSS
     562-597: Missing.
     747-759: LRLERSAGMMSCH → RIPPPPAHER...GDVAWAGPRK

Show »
Length:870
Mass (Da):95,720
Checksum:i59C6E7B4216708AA
GO
Isoform 13 (identifier: Q9Z351-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     372-372: Y → YSSQTQTYGAS
     571-606: Missing.
     747-759: LRLERSAGMMSCH → RIPPPPAHER...GDVAWAGPRK

Show »
Length:852
Mass (Da):93,906
Checksum:iBB27ADF9FA5BEE5D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7ZBV9B7ZBV9_MOUSE
Potassium voltage-gated channel sub...
Kcnq2
870Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7ZBV5B7ZBV5_MOUSE
Potassium voltage-gated channel sub...
Kcnq2
570Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7ZBV6B7ZBV6_MOUSE
Potassium voltage-gated channel sub...
Kcnq2
754Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7ZBV8B7ZBV8_MOUSE
Potassium voltage-gated channel sub...
Kcnq2
747Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7ZBW1B7ZBW1_MOUSE
Potassium voltage-gated channel sub...
Kcnq2
852Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7ZBV7B7ZBV7_MOUSE
Potassium voltage-gated channel sub...
Kcnq2
723Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7ZBV4B7ZBV4_MOUSE
Potassium voltage-gated channel sub...
Kcnq2
759Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7ZBW2B7ZBW2_MOUSE
Potassium voltage-gated channel sub...
Kcnq2
839Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JFQ2A0A0G2JFQ2_MOUSE
Potassium voltage-gated channel sub...
Kcnq2
842Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7ZBV3B7ZBV3_MOUSE
Potassium voltage-gated channel sub...
Kcnq2
726Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti125A → P in BAA37161 (PubMed:9666519).Curated1
Sequence conflicti326P → Q in BAA37160 (PubMed:9666519).Curated1
Sequence conflicti326P → Q in BAA37165 (PubMed:9666519).Curated1
Sequence conflicti326P → Q in AAM09696 (PubMed:12223552).Curated1
Sequence conflicti600H → Q in AAM09696 (PubMed:12223552).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_000991310 – 338GILGS…NPAAG → VSPAHLPTLEMLGVLEAPHK AWPWPTCEL in isoform 11. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_000992339 – 759Missing in isoform 11. 1 PublicationAdd BLAST421
Alternative sequenceiVSP_000993342 – 349SAWRFYAT → GQVRCAGH in isoform 9. 1 Publication8
Alternative sequenceiVSP_000995342 – 347SAWRFY → VSLSPC in isoform 10. 1 Publication6
Alternative sequenceiVSP_000996348 – 759Missing in isoform 10. 1 PublicationAdd BLAST412
Alternative sequenceiVSP_000994350 – 759Missing in isoform 9. 1 PublicationAdd BLAST410
Alternative sequenceiVSP_000997372Y → YSSQTQTYGAS in isoform 7, isoform 12 and isoform 13. 3 Publications1
Alternative sequenceiVSP_000998406 – 463SQKVS…GDRSR → RSVPPASSRPGVCCTHLALL SLCIHHVSWGRATMGPCVCF YVQQVTVCPGTPRVTSQL in isoform 7 and isoform 8. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_012365406S → SKGRPCRGCLCGCCPGHSS in isoform 12. 1 Publication1
Alternative sequenceiVSP_001000407 – 418Missing in isoform 3. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_000999464 – 759Missing in isoform 7 and isoform 8. 1 PublicationAdd BLAST296
Alternative sequenceiVSP_001005562 – 623IDMIV…ETELP → QEPLPVQSGHEQGPPGQNQA WHKGHQGLGDRCAEQGQYQL WRSLPTLLASCCFLLCFHTV CF in isoform 6. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_001002562 – 597Missing in isoform 4 and isoform 12. 2 PublicationsAdd BLAST36
Alternative sequenceiVSP_001001562 – 596IDMIV…PQYSP → QEPLPVQSGHEQGPPGQNQA WHKGHQGLGD in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_001003562 – 570IDMIVGPPP → SCDWRGVLA in isoform 5. 1 Publication9
Alternative sequenceiVSP_001004571 – 759Missing in isoform 5. 1 PublicationAdd BLAST189
Alternative sequenceiVSP_022637571 – 606Missing in isoform 13. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_001006624 – 759Missing in isoform 6. 1 PublicationAdd BLAST136
Alternative sequenceiVSP_012366747 – 759LRLER…MMSCH → RIPPPPAHERSLSAYGGGNR ASTEFLRLEGTPACRPSEAA LRDSDTSISIPSVDHEELER SFSGFSISQSKENLDALGSC YAAVAPCAKVRPYIAEGESD TDSDLCTPCGPPPRSATGEG PFGDVAWAGPRK in isoform 12 and isoform 13. 2 PublicationsAdd BLAST13

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB000494 mRNA Translation: BAA37156.1
AB000495 mRNA Translation: BAA37157.1
AB000496 mRNA Translation: BAA37158.1
AB000497 mRNA Translation: BAA37159.1
AB000498 mRNA Translation: BAA37160.1
AB000499 mRNA Translation: BAA37161.1
AB000500 mRNA Translation: BAA37162.1
AB000501 mRNA Translation: BAA37163.1
AB000502 mRNA Translation: BAA37164.1
AB000503 mRNA Translation: BAA37165.1
AB000504 mRNA Translation: BAA37166.1
AF490773 mRNA Translation: AAM09696.1
AK139411 mRNA Translation: BAE24000.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS17193.1 [Q9Z351-1]
CCDS17194.1 [Q9Z351-2]
CCDS17195.1 [Q9Z351-3]
CCDS17196.1 [Q9Z351-4]
CCDS17197.1 [Q9Z351-5]
CCDS17198.1 [Q9Z351-12]

NCBI Reference Sequences

More...RefSeqi		NP_001006675.1, NM_001006674.2
NP_001289817.1, NM_001302888.1
NP_034741.2, NM_010611.3

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...GeneIDi		16536

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:16536

UCSC genome browser

More...UCSCi		uc008olg.2, mouse [Q9Z351-11]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB000494 mRNA Translation: BAA37156.1
AB000495 mRNA Translation: BAA37157.1
AB000496 mRNA Translation: BAA37158.1
AB000497 mRNA Translation: BAA37159.1
AB000498 mRNA Translation: BAA37160.1
AB000499 mRNA Translation: BAA37161.1
AB000500 mRNA Translation: BAA37162.1
AB000501 mRNA Translation: BAA37163.1
AB000502 mRNA Translation: BAA37164.1
AB000503 mRNA Translation: BAA37165.1
AB000504 mRNA Translation: BAA37166.1
AF490773 mRNA Translation: AAM09696.1
AK139411 mRNA Translation: BAE24000.1
CCDSiCCDS17193.1 [Q9Z351-1]
CCDS17194.1 [Q9Z351-2]
CCDS17195.1 [Q9Z351-3]
CCDS17196.1 [Q9Z351-4]
CCDS17197.1 [Q9Z351-5]
CCDS17198.1 [Q9Z351-12]
RefSeqiNP_001006675.1, NM_001006674.2
NP_001289817.1, NM_001302888.1
NP_034741.2, NM_010611.3

3D structure databases

AlphaFoldDBiQ9Z351
SMRiQ9Z351
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi200918, 14 interactors
CORUMiQ9Z351
IntActiQ9Z351, 2 interactors
STRINGi10090.ENSMUSP00000122915

Chemistry databases

BindingDBiQ9Z351
ChEMBLiCHEMBL2985
DrugCentraliQ9Z351

PTM databases

iPTMnetiQ9Z351
PhosphoSitePlusiQ9Z351

Proteomic databases

PRIDEiQ9Z351
ProteomicsDBi263404 [Q9Z351-1]
263405 [Q9Z351-2]
263406 [Q9Z351-3]
263407 [Q9Z351-4]
263408 [Q9Z351-5]
263409 [Q9Z351-6]
263410 [Q9Z351-7]
263411 [Q9Z351-8]
263412 [Q9Z351-9]
263413 [Q9Z351-10]
263414 [Q9Z351-11]
263415 [Q9Z351-12]
263416 [Q9Z351-13]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		Q9Z351, 1 sequenced antibody

The DNASU plasmid repository

More...DNASUi		16536

Genome annotation databases

GeneIDi16536
KEGGimmu:16536
UCSCiuc008olg.2, mouse [Q9Z351-11]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		3785
MGIiMGI:1309503, Kcnq2

Phylogenomic databases

eggNOGiKOG1419, Eukaryota
InParanoidiQ9Z351
OrthoDBi1168835at2759

Enzyme and pathway databases

ReactomeiR-MMU-1296072, Voltage gated Potassium channels

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		16536, 1 hit in 73 CRISPR screens

Protein Ontology

More...PROi		PR:Q9Z351
RNActiQ9Z351, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Family and domain databases

InterProiView protein in InterPro
IPR005821, Ion_trans_dom
IPR003937, K_chnl_volt-dep_KCNQ
IPR003947, K_chnl_volt-dep_KCNQ2
IPR013821, K_chnl_volt-dep_KCNQ_C
IPR028325, VG_K_chnl
PANTHERiPTHR11537, PTHR11537, 1 hit
PTHR11537:SF6, PTHR11537:SF6, 1 hit
PfamiView protein in Pfam
PF00520, Ion_trans, 1 hit
PF03520, KCNQ_channel, 2 hits
PRINTSiPR01461, KCNQ2CHANNEL
PR01459, KCNQCHANNEL

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKCNQ2_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Z351
Secondary accession number(s): Q3UTI0
, Q8R498, Q9QWN9, Q9Z342, Q9Z343, Q9Z344, Q9Z345, Q9Z346, Q9Z347, Q9Z348, Q9Z349, Q9Z350
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: May 1, 1999
Last modified: May 25, 2022
This is version 177 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again