Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

C-C motif chemokine 27

Gene

Ccl27

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Chemotactic factor that attracts skin-associated memory T-lymphocytes. May play a role in mediating homing of lymphocytes to cutaneous sites. May play a role in cell migration during embryogenesis. Nuclear forms may facilitate cellular migration by inducing cytoskeletal relaxation. Binds to CCR10.

Caution

It is uncertain whether Met-1 or Met-2 is the initiator.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • chemokine activity Source: UniProtKB
  • cytokine activity Source: MGI

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCytokine

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-380108 Chemokine receptors bind chemokines
R-MMU-418594 G alpha (i) signalling events

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
C-C motif chemokine 27
Alternative name(s):
CC chemokine ILC
Cutaneous T-cell-attracting chemokine
Short name:
CTACK
ESkine
IL-11 R-alpha-locus chemokine
Short name:
ALP
Short name:
mILC
Skinkine
Small-inducible cytokine A27
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ccl27
Synonyms:Ilc, Scya27
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1343459 Ccl27

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus, Secreted

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 25Sequence analysisAdd BLAST25
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000524026 – 120C-C motif chemokine 27Add BLAST95

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi34 ↔ 63By similarity
Disulfide bondi35 ↔ 78By similarity

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Z1X0

PRoteomics IDEntifications database

More...
PRIDEi
Q9Z1X0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is predominantly expressed in placenta and weakly in skin. Isoform 2 is predominantly expressed in testes and brain, weakly in kidney and liver and even lower in heart and muscle. Low expression of both isoforms in other tissues.

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed during development.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000073877 Expressed in 30 organ(s), highest expression level in testis

CleanEx database of gene expression profiles

More...
CleanExi
MM_CCL27

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Z1X0 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer, dimer, and tetramer. Heparin avidly promotes oligomerization (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

Database of interacting proteins

More...
DIPi
DIP-5905N

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000137284

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9Z1X0

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Z1X0

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410J4BK Eukaryota
ENOG41118KC LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063923

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231671

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG050833

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Z1X0

KEGG Orthology (KO)

More...
KOi
K16598

Identification of Orthologs from Complete Genome Data

More...
OMAi
SCCTELS

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0OWP

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Z1X0

TreeFam database of animal gene trees

More...
TreeFami
TF337014

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001811 Chemokine_IL8-like_dom
IPR036048 Interleukin_8-like_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00048 IL8, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00199 SCY, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54117 SSF54117, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Z1X0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMEGLSPASS LPLLLLLLSP APEAALPLPS STSCCTQLYR QPLPSRLLRR
60 70 80 90 100
IVHMELQEAD GDCHLQAVVL HLARRSVCVH PQNRSLARWL ERQGKRLQGT
110 120
VPSLNLVLQK KMYSHPQQQN
Length:120
Mass (Da):13,464
Last modified:December 13, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD1EEE1270AB580BF
GO
Isoform 2 (identifier: Q9Z1X0-2) [UniParc]FASTAAdd to basket
Also known as: PESKY

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MMEGLSPASSLPLLLLLLSPAPEA → MWRRERSPMSPTSQRLSLEAPSLPLRSWHPWNKTKQKQE

Show »
Length:135
Mass (Da):15,774
Checksum:i956BBE8984B74389
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A2AMS5A2AMS5_MOUSE
Chemokine (C-C motif) ligand 27A
Ccl27a
119Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0R4J0X6A0A0R4J0X6_MOUSE
Chemokine (C-C motif) ligand 27A
Ccl27a
120Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2AMS6A2AMS6_MOUSE
Chemokine (C-C motif) ligand 27A
Ccl27a
127Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2AMS7A2AMS7_MOUSE
Chemokine (C-C motif) ligand 27A
Ccl27a
164Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2AMS8A2AMS8_MOUSE
Chemokine (C-C motif) ligand 27A
Ccl27a
87Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2I3BRY3A0A2I3BRY3_MOUSE
Chemokine (C-C motif) ligand 27A
Ccl27a
37Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2I3BQE5A0A2I3BQE5_MOUSE
Chemokine (C-C motif) ligand 27A
Ccl27a
40Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti115H → N in AAD04163 (PubMed:10329455).Curated1
Sequence conflicti115H → N in BAA88474 (PubMed:10556532).Curated1
Sequence conflicti115H → N in AAD41237 (PubMed:10588729).Curated1
Sequence conflicti115H → N in BAB24001 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0010651 – 24MMEGL…PAPEA → MWRRERSPMSPTSQRLSLEA PSLPLRSWHPWNKTKQKQE in isoform 2. 1 PublicationAdd BLAST24

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF099931 mRNA Translation: AAD04163.1
AB013398 mRNA Translation: BAA88474.1
AF082392 mRNA Translation: AAD41237.1
AK005520 mRNA Translation: BAB24095.1
AK005398 mRNA Translation: BAB24001.1
BC028511 mRNA Translation: AAH28511.1
BC107226 mRNA Translation: AAI07227.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS18072.1 [Q9Z1X0-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001157518.1, NM_001164046.1 [Q9Z1X0-1]
NP_001186888.1, NM_001199959.1 [Q9Z1X0-1]
NP_001186890.1, NM_001199961.1 [Q9Z1X0-2]
NP_001186891.1, NM_001199962.1 [Q9Z1X0-2]
NP_001186894.1, NM_001199965.1 [Q9Z1X0-1]
NP_001254631.1, NM_001267702.1 [Q9Z1X0-2]
NP_001254633.1, NM_001267704.1 [Q9Z1X0-1]
NP_035466.1, NM_011336.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.335946
Mm.425176
Mm.441242
Mm.490604
Mm.6660

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000098122; ENSMUSP00000095726; ENSMUSG00000073877 [Q9Z1X0-1]
ENSMUST00000108018; ENSMUSP00000103653; ENSMUSG00000073877 [Q9Z1X0-2]
ENSMUST00000177785; ENSMUSP00000137284; ENSMUSG00000096826 [Q9Z1X0-1]
ENSMUST00000177905; ENSMUSP00000136552; ENSMUSG00000093828 [Q9Z1X0-1]
ENSMUST00000179281; ENSMUSP00000136040; ENSMUSG00000095247 [Q9Z1X0-1]
ENSMUST00000179871; ENSMUSP00000137101; ENSMUSG00000095247 [Q9Z1X0-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
100039863
100039939
100040048
100861978
20301

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:100039863
mmu:100039939
mmu:100040048
mmu:100861978
mmu:20301

UCSC genome browser

More...
UCSCi
uc008sln.2 mouse [Q9Z1X0-1]
uc012dcl.1 mouse [Q9Z1X0-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

CCL27 entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF099931 mRNA Translation: AAD04163.1
AB013398 mRNA Translation: BAA88474.1
AF082392 mRNA Translation: AAD41237.1
AK005520 mRNA Translation: BAB24095.1
AK005398 mRNA Translation: BAB24001.1
BC028511 mRNA Translation: AAH28511.1
BC107226 mRNA Translation: AAI07227.1
CCDSiCCDS18072.1 [Q9Z1X0-1]
RefSeqiNP_001157518.1, NM_001164046.1 [Q9Z1X0-1]
NP_001186888.1, NM_001199959.1 [Q9Z1X0-1]
NP_001186890.1, NM_001199961.1 [Q9Z1X0-2]
NP_001186891.1, NM_001199962.1 [Q9Z1X0-2]
NP_001186894.1, NM_001199965.1 [Q9Z1X0-1]
NP_001254631.1, NM_001267702.1 [Q9Z1X0-2]
NP_001254633.1, NM_001267704.1 [Q9Z1X0-1]
NP_035466.1, NM_011336.1
UniGeneiMm.335946
Mm.425176
Mm.441242
Mm.490604
Mm.6660

3D structure databases

ProteinModelPortaliQ9Z1X0
SMRiQ9Z1X0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-5905N
STRINGi10090.ENSMUSP00000137284

Proteomic databases

PaxDbiQ9Z1X0
PRIDEiQ9Z1X0

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000098122; ENSMUSP00000095726; ENSMUSG00000073877 [Q9Z1X0-1]
ENSMUST00000108018; ENSMUSP00000103653; ENSMUSG00000073877 [Q9Z1X0-2]
ENSMUST00000177785; ENSMUSP00000137284; ENSMUSG00000096826 [Q9Z1X0-1]
ENSMUST00000177905; ENSMUSP00000136552; ENSMUSG00000093828 [Q9Z1X0-1]
ENSMUST00000179281; ENSMUSP00000136040; ENSMUSG00000095247 [Q9Z1X0-1]
ENSMUST00000179871; ENSMUSP00000137101; ENSMUSG00000095247 [Q9Z1X0-2]
GeneIDi100039863
100039939
100040048
100861978
20301
KEGGimmu:100039863
mmu:100039939
mmu:100040048
mmu:100861978
mmu:20301
UCSCiuc008sln.2 mouse [Q9Z1X0-1]
uc012dcl.1 mouse [Q9Z1X0-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
100040048
20301
MGIiMGI:1343459 Ccl27

Phylogenomic databases

eggNOGiENOG410J4BK Eukaryota
ENOG41118KC LUCA
GeneTreeiENSGT00530000063923
HOGENOMiHOG000231671
HOVERGENiHBG050833
InParanoidiQ9Z1X0
KOiK16598
OMAiSCCTELS
OrthoDBiEOG091G0OWP
PhylomeDBiQ9Z1X0
TreeFamiTF337014

Enzyme and pathway databases

ReactomeiR-MMU-380108 Chemokine receptors bind chemokines
R-MMU-418594 G alpha (i) signalling events

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9Z1X0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000073877 Expressed in 30 organ(s), highest expression level in testis
CleanExiMM_CCL27
GenevisibleiQ9Z1X0 MM

Family and domain databases

InterProiView protein in InterPro
IPR001811 Chemokine_IL8-like_dom
IPR036048 Interleukin_8-like_sf
PfamiView protein in Pfam
PF00048 IL8, 1 hit
SMARTiView protein in SMART
SM00199 SCY, 1 hit
SUPFAMiSSF54117 SSF54117, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCCL27_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Z1X0
Secondary accession number(s): Q3KNL1, Q9DAU6, Q9DAZ4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: December 13, 2002
Last modified: November 7, 2018
This is version 151 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again