Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

CD320 antigen

Gene

Cd320

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor for transcobalamin saturated with cobalamin (TCbl). Plays an important role in cobalamin uptake. Plasma membrane protein that is expressed on follicular dendritic cells (FDC) and mediates interaction with germinal center B cells. Functions as costimulator to promote B cell responses to antigenic stimuli; promotes B cell differentiation and proliferation. Germinal center-B (GC-B) cells differentiate into memory B-cells and plasma cells (PC) through interaction with T-cells and follicular dendritic cells (FDC). CD320 augments the proliferation of PC precursors generated by IL-10.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi65Calcium 1; via carbonyl oxygenBy similarity1
Metal bindingi68Calcium 1By similarity1
Metal bindingi70Calcium 1; via carbonyl oxygenBy similarity1
Metal bindingi72Calcium 1By similarity1
Metal bindingi78Calcium 1By similarity1
Metal bindingi79Calcium 1By similarity1
Metal bindingi142Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi145Calcium 2By similarity1
Metal bindingi147Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi149Calcium 2By similarity1
Metal bindingi155Calcium 2By similarity1
Metal bindingi156Calcium 2By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • B cell costimulation Source: UniProtKB
  • cobalamin transport Source: UniProtKB
  • positive regulation of B cell proliferation Source: UniProtKB
  • regulation of vitamin metabolic process Source: MGI

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGrowth factor
LigandMetal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-196741 Cobalamin (Cbl, vitamin B12) transport and metabolism

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
CD320 antigen
Alternative name(s):
Transcobalamin receptor
Short name:
TCblR
CD_antigen: CD320
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Cd320
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1860083 Cd320

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini29 – 208ExtracellularSequence analysisAdd BLAST180
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei209 – 229HelicalSequence analysisAdd BLAST21
Topological domaini230 – 260CytoplasmicSequence analysisAdd BLAST31

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 28Sequence analysisAdd BLAST28
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000035405229 – 260CD320 antigenAdd BLAST232

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi47 ↔ 60PROSITE-ProRule annotation
Disulfide bondi54 ↔ 73PROSITE-ProRule annotation
Disulfide bondi67 ↔ 82PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi118N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi124 ↔ 137PROSITE-ProRule annotation
Disulfide bondi131 ↔ 150PROSITE-ProRule annotation
Disulfide bondi144 ↔ 159PROSITE-ProRule annotation
Glycosylationi185N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Z1P5

PeptideAtlas

More...
PeptideAtlasi
Q9Z1P5

PRoteomics IDEntifications database

More...
PRIDEi
Q9Z1P5

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Z1P5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Z1P5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000002308 Expressed in 271 organ(s), highest expression level in placenta labyrinth

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Z1P5 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via LDL-receptor class A domains) with TCN2.By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000002379

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9Z1P5

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Z1P5

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini46 – 83LDL-receptor class A 1PROSITE-ProRule annotationAdd BLAST38
Domaini123 – 160LDL-receptor class A 2PROSITE-ProRule annotationAdd BLAST38

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1215 Eukaryota
ENOG410XP34 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00730000111436

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000111486

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG056019

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Z1P5

KEGG Orthology (KO)

More...
KOi
K06734

Identification of Orthologs from Complete Genome Data

More...
OMAi
RIEPCTQ

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0M4G

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Z1P5

TreeFam database of animal gene trees

More...
TreeFami
TF337215

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00112 LDLa, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036055 LDL_receptor-like_sf
IPR023415 LDLR_class-A_CS
IPR002172 LDrepeatLR_classA_rpt

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00057 Ldl_recept_a, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00261 LDLRECEPTOR

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00192 LDLa, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57424 SSF57424, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01209 LDLRA_1, 2 hits
PS50068 LDLRA_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9Z1P5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MARGGAGRAV ALGLVLRLLF GLRTGLEAAP APAHTRVQVS GSRADSCPTD
60 70 80 90 100
TFQCLTSGYC VPLSWRCDGD QDCSDGSDEE DCRIESCAQN GQCQPQSALP
110 120 130 140 150
CSCDNISGCS DVSDKNLNCS RPPCQESELH CILDDVCIPH TWRCDGHPDC
160 170 180 190 200
LDSSDELSCD TDTEIDKIFQ EENATTTRIS TTMENETSFR NVTFTSAGDS
210 220 230 240 250
SRNPSAYGVI AAAGVLSAIL VSATLLILLR LRGQGYLPPP GLLVAVKESL
260
LLSERKTSLI
Length:260
Mass (Da):27,739
Last modified:May 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5AA3B6081C8E080C
GO
Isoform 2 (identifier: Q9Z1P5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVS → MWAGRLLFLILTSHHAGLVTRYLLAA

Show »
Length:246
Mass (Da):26,609
Checksum:i4565AF0B7FF857DA
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAD91188 differs from that shown.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti74S → F in BAB32321 (PubMed:16141072).Curated1
Sequence conflicti125Q → H in BAE20743 (PubMed:16141072).Curated1
Sequence conflicti239P → T in BAC40198 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0357231 – 40MARGG…RVQVS → MWAGRLLFLILTSHHAGLVT RYLLAA in isoform 2. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF110520 Genomic DNA Translation: AAC97969.1
AF528162 Genomic DNA Translation: AAO17374.1
AK021187 mRNA Translation: BAB32321.1
AK078151 mRNA Translation: BAC37150.1
AK088189 mRNA Translation: BAC40198.1
AK131655 mRNA Translation: BAE20743.1
AK140204 mRNA Translation: BAE24278.1
CH466660 Genomic DNA Translation: EDL10217.1
BC026888 mRNA Translation: AAH26888.1
AJ560661, AJ560659, AJ560660 Genomic DNA Translation: CAD91188.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS28632.1 [Q9Z1P5-1]
CCDS79533.1 [Q9Z1P5-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001292098.1, NM_001305169.1 [Q9Z1P5-2]
NP_062294.3, NM_019421.3 [Q9Z1P5-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.11175

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000002379; ENSMUSP00000002379; ENSMUSG00000002308 [Q9Z1P5-1]
ENSMUST00000087559; ENSMUSP00000084839; ENSMUSG00000002308 [Q9Z1P5-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
54219

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:54219

UCSC genome browser

More...
UCSCi
uc008bzv.1 mouse [Q9Z1P5-1]
uc056zej.1 mouse [Q9Z1P5-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF110520 Genomic DNA Translation: AAC97969.1
AF528162 Genomic DNA Translation: AAO17374.1
AK021187 mRNA Translation: BAB32321.1
AK078151 mRNA Translation: BAC37150.1
AK088189 mRNA Translation: BAC40198.1
AK131655 mRNA Translation: BAE20743.1
AK140204 mRNA Translation: BAE24278.1
CH466660 Genomic DNA Translation: EDL10217.1
BC026888 mRNA Translation: AAH26888.1
AJ560661, AJ560659, AJ560660 Genomic DNA Translation: CAD91188.1 Sequence problems.
CCDSiCCDS28632.1 [Q9Z1P5-1]
CCDS79533.1 [Q9Z1P5-2]
RefSeqiNP_001292098.1, NM_001305169.1 [Q9Z1P5-2]
NP_062294.3, NM_019421.3 [Q9Z1P5-1]
UniGeneiMm.11175

3D structure databases

ProteinModelPortaliQ9Z1P5
SMRiQ9Z1P5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000002379

PTM databases

iPTMnetiQ9Z1P5
PhosphoSitePlusiQ9Z1P5

Proteomic databases

PaxDbiQ9Z1P5
PeptideAtlasiQ9Z1P5
PRIDEiQ9Z1P5

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000002379; ENSMUSP00000002379; ENSMUSG00000002308 [Q9Z1P5-1]
ENSMUST00000087559; ENSMUSP00000084839; ENSMUSG00000002308 [Q9Z1P5-2]
GeneIDi54219
KEGGimmu:54219
UCSCiuc008bzv.1 mouse [Q9Z1P5-1]
uc056zej.1 mouse [Q9Z1P5-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51293
MGIiMGI:1860083 Cd320

Phylogenomic databases

eggNOGiKOG1215 Eukaryota
ENOG410XP34 LUCA
GeneTreeiENSGT00730000111436
HOGENOMiHOG000111486
HOVERGENiHBG056019
InParanoidiQ9Z1P5
KOiK06734
OMAiRIEPCTQ
OrthoDBiEOG091G0M4G
PhylomeDBiQ9Z1P5
TreeFamiTF337215

Enzyme and pathway databases

ReactomeiR-MMU-196741 Cobalamin (Cbl, vitamin B12) transport and metabolism

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9Z1P5

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000002308 Expressed in 271 organ(s), highest expression level in placenta labyrinth
GenevisibleiQ9Z1P5 MM

Family and domain databases

CDDicd00112 LDLa, 2 hits
InterProiView protein in InterPro
IPR036055 LDL_receptor-like_sf
IPR023415 LDLR_class-A_CS
IPR002172 LDrepeatLR_classA_rpt
PfamiView protein in Pfam
PF00057 Ldl_recept_a, 2 hits
PRINTSiPR00261 LDLRECEPTOR
SMARTiView protein in SMART
SM00192 LDLa, 2 hits
SUPFAMiSSF57424 SSF57424, 2 hits
PROSITEiView protein in PROSITE
PS01209 LDLRA_1, 2 hits
PS50068 LDLRA_2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCD320_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Z1P5
Secondary accession number(s): Q3V2Q4
, Q7TSW0, Q8C2Q4, Q9CWC2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 16, 2008
Last sequence update: May 1, 1999
Last modified: November 7, 2018
This is version 133 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again