Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1

Gene

Plcb1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.By similarity

Miscellaneous

The receptor-mediated activation of PLC-beta-1 is mediated by two G-protein alpha subunits, alpha-Q and alpha-11.

Catalytic activityi

1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

Cofactori

Ca2+By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei331PROSITE-ProRule annotation1
Active sitei378PROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

  • activation of meiosis involved in egg activation Source: BHF-UCL
  • brain development Source: BHF-UCL
  • cell adhesion Source: BHF-UCL
  • cellular response to fluoride Source: MGI
  • cellular response to glyceraldehyde Source: MGI
  • cellular response to ionomycin Source: MGI
  • cellular response to vasopressin Source: MGI
  • cerebral cortex development Source: BHF-UCL
  • erythrocyte differentiation Source: BHF-UCL
  • fat cell differentiation Source: BHF-UCL
  • G2/M transition of mitotic cell cycle Source: BHF-UCL
  • glutamate receptor signaling pathway Source: BHF-UCL
  • G-protein coupled acetylcholine receptor signaling pathway Source: BHF-UCL
  • inositol trisphosphate metabolic process Source: MGI
  • insulin-like growth factor receptor signaling pathway Source: BHF-UCL
  • insulin receptor signaling pathway Source: BHF-UCL
  • interleukin-12-mediated signaling pathway Source: BHF-UCL
  • interleukin-15-mediated signaling pathway Source: BHF-UCL
  • interleukin-1-mediated signaling pathway Source: MGI
  • intracellular signal transduction Source: InterPro
  • macrophage differentiation Source: BHF-UCL
  • memory Source: BHF-UCL
  • mRNA processing Source: BHF-UCL
  • negative regulation of monocyte extravasation Source: BHF-UCL
  • negative regulation of transcription, DNA-templated Source: BHF-UCL
  • oocyte maturation Source: BHF-UCL
  • phosphatidylinositol catabolic process Source: MGI
  • phosphatidylinositol metabolic process Source: BHF-UCL
  • positive regulation of acrosome reaction Source: BHF-UCL
  • positive regulation of CD24 biosynthetic process Source: BHF-UCL
  • positive regulation of developmental growth Source: BHF-UCL
  • positive regulation of embryonic development Source: BHF-UCL
  • positive regulation of G1/S transition of mitotic cell cycle Source: BHF-UCL
  • positive regulation of interleukin-12 production Source: BHF-UCL
  • positive regulation of JNK cascade Source: BHF-UCL
  • positive regulation of myoblast differentiation Source: BHF-UCL
  • positive regulation of sodium:proton antiporter activity Source: BHF-UCL
  • positive regulation of transcription, DNA-templated Source: BHF-UCL
  • regulation of fertilization Source: BHF-UCL
  • regulation of G-protein coupled receptor protein signaling pathway Source: BHF-UCL
  • response to monosaccharide Source: MGI
  • response to peptide hormone Source: MGI
  • signal transduction Source: BHF-UCL

Keywordsi

Molecular functionHydrolase, Transducer
Biological processLipid degradation, Lipid metabolism
LigandCalcium

Enzyme and pathway databases

BRENDAi3.1.4.11 3474
ReactomeiR-MMU-112043 PLC beta mediated events
R-MMU-1855204 Synthesis of IP3 and IP4 in the cytosol
R-MMU-399997 Acetylcholine regulates insulin secretion
R-MMU-4086398 Ca2+ pathway
R-MMU-416476 G alpha (q) signalling events
R-MMU-418217 G beta:gamma signalling through PLC beta
R-MMU-434316 Fatty Acids bound to GPR40 (FFAR1) regulate insulin secretion
R-MMU-500657 Presynaptic function of Kainate receptors

Names & Taxonomyi

Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 (EC:3.1.4.11)
Alternative name(s):
PLC-154
Phosphoinositide phospholipase C-beta-1
Phospholipase C-beta-1
Short name:
PLC-beta-1
Gene namesi
Name:Plcb1
Synonyms:Plcb
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:97613 Plcb1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000884871 – 12161-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1Add BLAST1216

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei236PhosphoserineCombined sources1
Modified residuei417PhosphoserineCombined sources1
Modified residuei509PhosphothreonineCombined sources1
Modified residuei511PhosphoserineCombined sources1
Modified residuei582PhosphoserineCombined sources1
Modified residuei887Phosphoserine; by PKCBy similarity1
Modified residuei978PhosphoserineCombined sources1
Modified residuei987PhosphoserineCombined sources1
Modified residuei1197PhosphoserineCombined sources1
Modified residuei1199PhosphoserineCombined sources1
Modified residuei1200PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9Z1B3
PeptideAtlasiQ9Z1B3
PRIDEiQ9Z1B3

PTM databases

iPTMnetiQ9Z1B3
PhosphoSitePlusiQ9Z1B3
SwissPalmiQ9Z1B3

Expressioni

Gene expression databases

BgeeiENSMUSG00000051177
CleanExiMM_PLCB1
ExpressionAtlasiQ9Z1B3 baseline and differential
GenevisibleiQ9Z1B3 MM

Interactioni

Subunit structurei

Interacts with DGKQ.By similarity

GO - Molecular functioni

  • calmodulin binding Source: BHF-UCL
  • enzyme binding Source: BHF-UCL
  • lamin binding Source: BHF-UCL
  • protein homodimerization activity Source: BHF-UCL

Protein-protein interaction databases

BioGridi202232, 2 interactors
IntActiQ9Z1B3, 5 interactors
MINTiQ9Z1B3
STRINGi10090.ENSMUSP00000105743

Structurei

3D structure databases

ProteinModelPortaliQ9Z1B3
SMRiQ9Z1B3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini316 – 467PI-PLC X-boxPROSITE-ProRule annotationAdd BLAST152
Domaini540 – 656PI-PLC Y-boxPROSITE-ProRule annotationAdd BLAST117
Domaini663 – 761C2PROSITE-ProRule annotationAdd BLAST99

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi914 – 1088Lys-richAdd BLAST175

Phylogenomic databases

eggNOGiKOG0169 Eukaryota
ENOG410XPSW LUCA
GeneTreeiENSGT00760000118936
HOVERGENiHBG053609
InParanoidiQ9Z1B3
KOiK05858
OMAiMIRSYIQ
OrthoDBiEOG091G00XL
TreeFamiTF313216

Family and domain databases

CDDicd13361 PH_PLC_beta, 1 hit
Gene3Di2.60.40.150, 1 hit
3.20.20.190, 2 hits
InterProiView protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR011992 EF-hand-dom_pair
IPR001192 PI-PLC_fam
IPR016280 PLC-beta
IPR028400 PLC-beta1
IPR014815 PLC-beta_C
IPR009535 PLC-beta_CS
IPR037862 PLC-beta_PH
IPR017946 PLC-like_Pdiesterase_TIM-brl
IPR015359 PLC_EF-hand-like
IPR000909 PLipase_C_PInositol-sp_X_dom
IPR001711 PLipase_C_Pinositol-sp_Y
PANTHERiPTHR10336 PTHR10336, 1 hit
PTHR10336:SF12 PTHR10336:SF12, 1 hit
PfamiView protein in Pfam
PF06631 DUF1154, 1 hit
PF09279 EF-hand_like, 1 hit
PF00388 PI-PLC-X, 1 hit
PF00387 PI-PLC-Y, 1 hit
PF08703 PLC-beta_C, 1 hit
PIRSFiPIRSF000956 PLC-beta, 1 hit
PRINTSiPR00390 PHPHLIPASEC
SMARTiView protein in SMART
SM00239 C2, 1 hit
SM00148 PLCXc, 1 hit
SM00149 PLCYc, 1 hit
SUPFAMiSSF47473 SSF47473, 1 hit
SSF51695 SSF51695, 1 hit
PROSITEiView protein in PROSITE
PS50004 C2, 1 hit
PS50007 PIPLC_X_DOMAIN, 1 hit
PS50008 PIPLC_Y_DOMAIN, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform A (identifier: Q9Z1B3-1) [UniParc]FASTAAdd to basket
Also known as: C-beta-1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGAQPGVHA LQLKPVCVSD SLKKGTKFVK WDDDSTIVTP IILRTDPQGF
60 70 80 90 100
FFYWTDQNKE TELLDLSLVK DARCGKHAKA PKDPKLRELL DVGNIGHLEQ
110 120 130 140 150
RMITVVYGPD LVNISHLNLV AFQEEVAKEW TNEVFSLATN LLAQNMSRDA
160 170 180 190 200
FLEKAYTKLK LQVTPEGRIP LKNIYRLFSA DRKRVETALE ACSLPSSRND
210 220 230 240 250
SIPQEDFTPD VYRVFLNNLC PRPEIDNIFS EFGAKSKPYL TVDQMMDFIN
260 270 280 290 300
LKQRDPRLNE ILYPPLKQEQ VQVLIEKYEP NSSLAKKGQM SVDGFMRYLS
310 320 330 340 350
GEENGVVSPE KLDLNEDMSQ PLSHYFINSS HNTYLTAGQL AGNSSVEMYR
360 370 380 390 400
QVLLSGCRCV ELDCWKGRTA EEEPVITHGF TMTTEISFKE VIEAIAECAF
410 420 430 440 450
KTSPFPILLS FENHVDSPKQ QAKMAEYCRL IFGDALLMEP LEKYPLESGV
460 470 480 490 500
PLPSPMDLMY KILVKNKKKS HKSSEGSGKK KLSEQASNTY SDSSSVFEPS
510 520 530 540 550
SPGAGEADTE SDDDDDDDDC KKSSMDEGTA GSEAMATEEM SNLVNYIQPV
560 570 580 590 600
KFESFEISKK RNKSFEMSSF VETKGLEQLT KSPVEFVEYN KMQLSRIYPK
610 620 630 640 650
GTRVDSSNYM PQLFWNAGCQ MVALNFQTVD LAMQINMGMY EYNGKSGYRL
660 670 680 690 700
KPEFMRRPDK HFDPFTEGIV DGIVANTLSV KIISGQFLSD KKVGTYVEVD
710 720 730 740 750
MFGLPVDTRR KAFKTKTSQG NAVNPVWEEE PIVFKKVVLP SLACLRIAAY
760 770 780 790 800
EEGGKFIGHR ILPVQAIRPG YHYICLRNER NQPLTLPAVF VYIEVKDYVP
810 820 830 840 850
DTYADVIEAL SNPIRYVNLM EQRAKQLAAL TLEDEEEVKK EADPGETSSE
860 870 880 890 900
APSETRTTPA ENGVNHTASL APKPPSQAPH SQPAPGSVKA PAKTEDLIQS
910 920 930 940 950
VLTEVEAQTI EELKQQKSFV KLQKKHYKEM KDLVKRHHKK TTELIKEHTT
960 970 980 990 1000
KYNEIQNDYL RRRAALEKSA KKDSKKKSEP SSPDHGSSAI EQDLAALDAE
1010 1020 1030 1040 1050
MTQKLIDLKD KQQQQLLNLR QEQYYSEKYQ KREHIKLLIQ KLTDVAEECQ
1060 1070 1080 1090 1100
NNQLKKLKEI CEKEKKELKK KMDKKRQEKI TEAKSKDKSQ MEEEKTEMIR
1110 1120 1130 1140 1150
SYIQEVVQYI KRLEEAQSKR QEKLVEKHNE IRQQILDEKP KLQTELEQEY
1160 1170 1180 1190 1200
QDKFKRLPLE ILEFVQEAMK GKISEDSNHG SAPPSLASDA AKVNLKSPSS
1210
EEIERENPGR EFDTPL
Length:1,216
Mass (Da):138,396
Last modified:July 27, 2011 - v2
Checksum:iCC751D49895A47D0
GO
Isoform B (identifier: Q9Z1B3-2) [UniParc]FASTAAdd to basket
Also known as: C-beta-1b

The sequence of this isoform differs from the canonical sequence as follows:
     1142-1216: LQTELEQEYQ...NPGREFDTPL → GEGPSSVLSEGCHEDPSVPPNFTPPNPQALKW

Show »
Length:1,173
Mass (Da):133,327
Checksum:i5AA8EEB1FCED1D93
GO
Isoform C (identifier: Q9Z1B3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1199-1216: Missing.

Note: No experimental confirmation available.
Show »
Length:1,198
Mass (Da):136,309
Checksum:iE95E5F34E58C48CA
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti28F → L in AAD00571 (Ref. 1) Curated1
Sequence conflicti28F → L in AAD00572 (Ref. 1) Curated1
Sequence conflicti28F → L in AAD00573 (Ref. 1) Curated1
Sequence conflicti41I → T in AAD00571 (Ref. 1) Curated1
Sequence conflicti41I → T in AAD00572 (Ref. 1) Curated1
Sequence conflicti41I → T in AAD00573 (Ref. 1) Curated1
Sequence conflicti67S → T in AAD01749 (PubMed:9753089).Curated1
Sequence conflicti79K → E in AAD00571 (Ref. 1) Curated1
Sequence conflicti79K → E in AAD00572 (Ref. 1) Curated1
Sequence conflicti79K → E in AAD00573 (Ref. 1) Curated1
Sequence conflicti112V → A in AAD00571 (Ref. 1) Curated1
Sequence conflicti112V → A in AAD00572 (Ref. 1) Curated1
Sequence conflicti112V → A in AAD00573 (Ref. 1) Curated1
Sequence conflicti561R → I in CAA64637 (PubMed:8687404).Curated1
Sequence conflicti613L → I in CAA64637 (PubMed:8687404).Curated1
Sequence conflicti622V → M in AAD00571 (Ref. 1) Curated1
Sequence conflicti622V → M in AAD00572 (Ref. 1) Curated1
Sequence conflicti622V → M in AAD00573 (Ref. 1) Curated1
Sequence conflicti714K → T in AAD00571 (Ref. 1) Curated1
Sequence conflicti714K → T in AAD00572 (Ref. 1) Curated1
Sequence conflicti714K → T in AAD00573 (Ref. 1) Curated1
Sequence conflicti795V → D in AAD00571 (Ref. 1) Curated1
Sequence conflicti795V → D in AAD00572 (Ref. 1) Curated1
Sequence conflicti795V → D in AAD00573 (Ref. 1) Curated1
Sequence conflicti923Q → H in AAD00571 (Ref. 1) Curated1
Sequence conflicti923Q → H in AAD00572 (Ref. 1) Curated1
Sequence conflicti923Q → H in AAD00573 (Ref. 1) Curated1
Sequence conflicti957N → I in AAD00571 (Ref. 1) Curated1
Sequence conflicti957N → I in AAD00572 (Ref. 1) Curated1
Sequence conflicti957N → I in AAD00573 (Ref. 1) Curated1
Sequence conflicti1084K → T in AAD00571 (Ref. 1) Curated1
Sequence conflicti1084K → T in AAD00572 (Ref. 1) Curated1
Sequence conflicti1084K → T in AAD00573 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0089171142 – 1216LQTEL…FDTPL → GEGPSSVLSEGCHEDPSVPP NFTPPNPQALKW in isoform B. 1 PublicationAdd BLAST75
Alternative sequenceiVSP_0089181199 – 1216Missing in isoform C. 1 PublicationAdd BLAST18

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U85712 mRNA Translation: AAD00571.1
U85713 mRNA Translation: AAD00572.1
U85714 mRNA Translation: AAD00573.1
AF498249 mRNA Translation: AAM22966.1
AF498250 mRNA Translation: AAM22967.1
AL928635
, AL840635, AL928956, AL935278 Genomic DNA Translation: CAM23602.1
AL840635
, AL928635, AL928956, AL935278 Genomic DNA Translation: CAM23766.1
AL928956
, AL840635, AL928635, AL935278 Genomic DNA Translation: CAM26804.1
AL935278
, AL840635, AL928635, AL928956 Genomic DNA Translation: CAM27130.1
BC058710 mRNA Translation: AAH58710.1
AF022801 mRNA Translation: AAD01749.1
X95344 mRNA Translation: CAA64637.1
CCDSiCCDS16787.1 [Q9Z1B3-2]
CCDS50729.1 [Q9Z1B3-1]
PIRiS68256
RefSeqiNP_001139302.1, NM_001145830.1 [Q9Z1B3-1]
NP_062651.2, NM_019677.2 [Q9Z1B3-2]
UniGeneiMm.330607

Genome annotation databases

EnsembliENSMUST00000070724; ENSMUSP00000064844; ENSMUSG00000051177 [Q9Z1B3-2]
ENSMUST00000110116; ENSMUSP00000105743; ENSMUSG00000051177 [Q9Z1B3-1]
ENSMUST00000131552; ENSMUSP00000118756; ENSMUSG00000051177 [Q9Z1B3-2]
GeneIDi18795
KEGGimmu:18795
UCSCiuc008mnx.2 mouse [Q9Z1B3-2]
uc008mny.2 mouse [Q9Z1B3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPLCB1_MOUSE
AccessioniPrimary (citable) accession number: Q9Z1B3
Secondary accession number(s): Q62075
, Q6PDH1, Q8K5A5, Q8K5A6, Q9Z0E5, Q9Z2T5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 14, 2003
Last sequence update: July 27, 2011
Last modified: June 20, 2018
This is version 166 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health