Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 122 (07 Apr 2021)
Sequence version 1 (01 May 1999)
Previous versions | rss
Add a publicationFeedback
Protein

Adhesion G protein-coupled receptor L3

Gene

Adgrl3

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in cell-cell adhesion and neuron guidance via its interactions with FLRT2 and FLRT3 that are expressed at the surface of adjacent cells. Plays a role in the development of glutamatergic synapses in the cortex. Important in determining the connectivity rates between the principal neurons in the cortex.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi332CalciumBy similarity1
Metal bindingi380CalciumBy similarity1
Metal bindingi381Calcium; via carbonyl oxygenBy similarity1
Metal bindingi435Calcium; via carbonyl oxygen1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer
LigandLectin, Metal-binding

Protein family/group databases

MEROPS protease database

More...
MEROPSi
P02.011

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Adhesion G protein-coupled receptor L3Imported
Alternative name(s):
Calcium-independent alpha-latrotoxin receptor 31 Publication
Short name:
CIRL-31 Publication
Latrophilin-3Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Adgrl3Imported
Synonyms:Cirl31 Publication, Cl31 Publication, Lphn3Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Rat genome database

More...
RGDi
620836, Adgrl3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini20 – 948ExtracellularSequence analysisAdd BLAST929
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei949 – 969Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini970 – 977CytoplasmicSequence analysis8
Transmembranei978 – 998Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini999 – 1006ExtracellularSequence analysis8
Transmembranei1007 – 1027Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini1028 – 1048CytoplasmicSequence analysisAdd BLAST21
Transmembranei1049 – 1069Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini1070 – 1087ExtracellularSequence analysisAdd BLAST18
Transmembranei1088 – 1108Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini1109 – 1141CytoplasmicSequence analysisAdd BLAST33
Transmembranei1142 – 1162Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini1163 – 1168ExtracellularSequence analysis6
Transmembranei1169 – 1189Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini1190 – 1550CytoplasmicSequence analysisAdd BLAST361

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Chemistry databases

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
208

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 19Sequence analysisAdd BLAST19
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000027014120 – 1550Adhesion G protein-coupled receptor L3Add BLAST1531

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi104 ↔ 134By similarity
Disulfide bondi113 ↔ 191By similarity
Disulfide bondi146 ↔ 178By similarity
Disulfide bondi159 ↔ 165By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi161N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi203 ↔ 385PROSITE-ProRule annotation
Glycosylationi532N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi616N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi839N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi884N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi910N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi999N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1165N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1253PhosphoserineBy similarity1
Modified residuei1535PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit.By similarity
O-glycosylated (major) and N-glycosylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Z173

PRoteomics IDEntifications database

More...
PRIDEi
Q9Z173

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q9Z173, 8 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Z173

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Z173

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Predominantly expressed in brain, followed by heart, placenta, pancreas, kidney and testis.1 Publication

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via olfactomedin-like domain) with FLRT3 (via extracellular domain); the interaction is direct (PubMed:22405201).

Identified in a complex with FLRT3 and UNC5B; does not interact with UNC5B by itself.

Identified in a complex with FLRT3 and UNC5D; does not interact with UNC5D by itself (By similarity).

Interacts (via olfactomedin-like domain) with FLRT1 (via extracellular domain).

Interacts (via olfactomedin-like domain) with FLRT2 (via extracellular domain).

Interacts (via extracellular domain) with TENM1.

Interacts (via extracellular domain) with TENM3 (By similarity).

By similarity1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
250970, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000056687

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Z173

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini103 – 192SUEL-type lectinPROSITE-ProRule annotationAdd BLAST90
Domaini202 – 461Olfactomedin-likePROSITE-ProRule annotationAdd BLAST260
Domaini882 – 933GPSPROSITE-ProRule annotationAdd BLAST52

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni317 – 347Interaction with FLRT3By similarityAdd BLAST31

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1483 – 1486Poly-Ala4

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The Olfactomedin-like domain is required for the synapse-promoting function and the interaction with FLRT3. The Olfactomedin-like and the SUEL-type lectin domains are required for the interaction with TENM1 (By similarity).By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3545, Eukaryota
KOG4193, Eukaryota
KOG4729, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Z173

Database of Orthologous Groups

More...
OrthoDBi
388923at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Z173

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.120.740, 1 hit
4.10.1240.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR032471, GAIN_dom_N
IPR017981, GPCR_2-like
IPR036445, GPCR_2_extracell_dom_sf
IPR001879, GPCR_2_extracellular_dom
IPR003924, GPCR_2_latrophilin
IPR003334, GPCR_2_latrophilin_rcpt_C
IPR000832, GPCR_2_secretin-like
IPR017983, GPCR_2_secretin-like_CS
IPR000203, GPS
IPR015630, Latrophilin-3
IPR000922, Lectin_gal-bd_dom
IPR043159, Lectin_gal-bd_sf
IPR003112, Olfac-like_dom

The PANTHER Classification System

More...
PANTHERi
PTHR12011:SF60, PTHR12011:SF60, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00002, 7tm_2, 1 hit
PF16489, GAIN, 1 hit
PF02140, Gal_Lectin, 1 hit
PF01825, GPS, 1 hit
PF02354, Latrophilin, 2 hits
PF02191, OLF, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00249, GPCRSECRETIN
PR01444, LATROPHILIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00303, GPS, 1 hit
SM00008, HormR, 1 hit
SM00284, OLF, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00650, G_PROTEIN_RECEP_F2_2, 1 hit
PS50227, G_PROTEIN_RECEP_F2_3, 1 hit
PS50261, G_PROTEIN_RECEP_F2_4, 1 hit
PS50221, GPS, 1 hit
PS51132, OLF, 1 hit
PS50228, SUEL_LECTIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Z173-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MCPPQLFILM MLLAPVVHGG KHNERHPALA APLRHAEHSP GGPLPPRHLL
60 70 80 90 100
QQPAAERSTA HRGQGPRGTA RGVRGPGAPG AQIAAQAFSR APIPMAVVRR
110 120 130 140 150
ELSCESYPIE LRCPGTDVIM IESANYGRTD DKICDSDPAQ MENIRCYLPD
160 170 180 190 200
AYKIMSQRCN NRTQCAVVAG PDVFPDPCPG TYKYLEVQYE CVPYKVEQKV
210 220 230 240 250
FLCPGLLKGV YQSEHLFESD HQSGAWCKDP LQASDKIYYM PWTPYRTDTL
260 270 280 290 300
TEYSSKDDFI AGRPTTTYKL PHRVDGTGFV VYDGALFFNK ERTRNIVKFD
310 320 330 340 350
LRTRIKSGEA IIANANYHDT SPYRWGGKSD IDLAVDENGL WVIYATEQNN
360 370 380 390 400
GKIVISQLNP YTLRIEGTWD TAYDKRSASN AFMICGILYV VKSVYEDDDN
410 420 430 440 450
EATGNKIDYI YNTDQSKDSL VDVPFPNSYQ YIAAVDYNPR DNLLYVWNNY
460 470 480 490 500
HVVKYSLDFG PLDSRSGPVH HGQVSYISPP IHLDSDLERP PVRGISTTGP
510 520 530 540 550
LGMGSTTTST TLRTTTWNLG RSTTPSLPGR RNRSTSTPSP AIEVLDVTTH
560 570 580 590 600
LPSAASQIPA MEESCEAVEA REIMWFKTRQ GQVAKQSCPA GTIGVSTYLC
610 620 630 640 650
LAPDGIWDPQ GPDLSNCSSP WVNHITQKLK SGETAANIAR ELAEQTRNHL
660 670 680 690 700
NAGDITYSVR AMDQLVGLLD VQLRNLTPGG KDSAARSLNK LQKRERSCRA
710 720 730 740 750
YVQAMVETVN NLLQPQALNA WRDLTTSDQL RAATMLLDTV EESAFVLADN
760 770 780 790 800
LLKTDIVREN TDNIQLEVAR LSTEGNLEDL KFPENTGHGS TIQLSANTLK
810 820 830 840 850
QNGRNGEIRV AFVLYNNLGP YLSTENASMK LGTEAMSTNH SVIVNSPVIT
860 870 880 890 900
AAINKEFSNK VYLADPVVFT VKHIKQSEEN FNPNCSFWSY SKRTMTGYWS
910 920 930 940 950
TQGCRLLTTN KTHTTCSCNH LTNFAVLMAH VEVKHSDAVH DLLLDVITWV
960 970 980 990 1000
GILLSLVCLL ICIFTFCFFR GLQSDRNTIH KNLCISLFVA ELLFLIGINR
1010 1020 1030 1040 1050
TDQPIACAVF AALLHFFFLA AFTWMFLEGV QLYIMLVEVF ESEHSRRKYF
1060 1070 1080 1090 1100
YLVGYGMPAL IVAVSAAVDY RSYGTDKVCW LRLDTYFIWS FIGPATLIIM
1110 1120 1130 1140 1150
LNVIFLGIAL YKMFHHTAIL KPESGCLDNI NYEDNRPFIK SWVIGAIALL
1160 1170 1180 1190 1200
CLLGLTWAFG LMYINESTVI MAYLFTIFNS LQGMFIFIFH CVLQKKVRKE
1210 1220 1230 1240 1250
YGKCLRTHCC SGKSTESSIG SGKTSGSRTP GRYSTGSQSR IRRMWNDTVR
1260 1270 1280 1290 1300
KQSESSFITG DINSSASLNR GSYLPCIQAC VTYLEGLLNN ARDTSVMDTL
1310 1320 1330 1340 1350
PLNGNHGNSY SIAGGEYLSN CVQIIDRGYN HNETALEKKI LKELTSNYIP
1360 1370 1380 1390 1400
SYLNNHERSS EQNRNMMNKL VDNLGSGSED DAIVLDDAAS FNHEESLGLE
1410 1420 1430 1440 1450
LIHEESDAPL LPPRVYSTDN HQPHHYSRRR LPQDHSESFF PLLTDEHTED
1460 1470 1480 1490 1500
PQSPHRDSLY TSMPALAGVP AADSVTTSTQ TEAAAAKGGD AEDVYYKSMP
1510 1520 1530 1540 1550
NLGSRNHVHP LHAYYQLGRG SSDGFIVPPN KDGASPEGTS KGPAHLVTSL
Length:1,550
Mass (Da):172,442
Last modified:May 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA2E8091B2B34DB36
GO
Isoform 2 (identifier: Q9Z173-2) [UniParc]FASTAAdd to basket
Also known as: CL3AA

The sequence of this isoform differs from the canonical sequence as follows:
     19-86: Missing.
     1131-1139: Missing.
     1271-1284: Missing.

Show »
Length:1,459
Mass (Da):162,831
Checksum:iF083B7E81180E1A8
GO
Isoform 3 (identifier: Q9Z173-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1131-1139: Missing.
     1271-1284: Missing.

Show »
Length:1,527
Mass (Da):169,780
Checksum:iA0F1FFC2D9B50B9F
GO
Isoform 4 (identifier: Q9Z173-4) [UniParc]FASTAAdd to basket
Also known as: CL3BB

The sequence of this isoform differs from the canonical sequence as follows:
     1131-1139: Missing.
     1271-1307: GSYLPCIQACVTYLEGLLNNARDTSVMDTLPLNGNHG → EPYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW
     1308-1550: Missing.

Show »
Length:1,298
Mass (Da):144,892
Checksum:i26C05A298C6B1A02
GO
Isoform 5 (identifier: Q9Z173-5) [UniParc]FASTAAdd to basket
Also known as: CL3AB

The sequence of this isoform differs from the canonical sequence as follows:
     19-86: Missing.
     1131-1139: Missing.
     1271-1307: GSYLPCIQACVTYLEGLLNNARDTSVMDTLPLNGNHG → EPYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW
     1308-1550: Missing.

Show »
Length:1,230
Mass (Da):137,943
Checksum:i691DDCD1FE095C12
GO
Isoform 6 (identifier: Q9Z173-6) [UniParc]FASTAAdd to basket
Also known as: CL3BC

The sequence of this isoform differs from the canonical sequence as follows:
     1131-1139: Missing.
     1272-1350: SYLPCIQACV...LKELTSNYIP → TMANHLMSNA...KCHGYSTTEW
     1351-1550: Missing.

Show »
Length:1,341
Mass (Da):149,502
Checksum:iF73C8CEB1B657008
GO
Isoform 7 (identifier: Q9Z173-7) [UniParc]FASTAAdd to basket
Also known as: CL3AC

The sequence of this isoform differs from the canonical sequence as follows:
     19-86: Missing.
     1131-1139: Missing.
     1272-1350: SYLPCIQACV...LKELTSNYIP → TMANHLMSNA...KCHGYSTTEW
     1351-1550: Missing.

Show »
Length:1,273
Mass (Da):142,554
Checksum:iAE10D88D147CF078
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D4AAL4D4AAL4_RAT
Adhesion G protein-coupled receptor...
Adgrl3 Lphn3
1,550Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3ZH59D3ZH59_RAT
Adhesion G protein-coupled receptor...
Adgrl3 Lphn3
1,255Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F1LRG7F1LRG7_RAT
Adhesion G protein-coupled receptor...
Adgrl3 Lphn3
854Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_02212719 – 86Missing in isoform 2, isoform 5 and isoform 7. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_0221281131 – 1139Missing in isoform 2, isoform 3, isoform 4, isoform 5, isoform 6 and isoform 7. 1 Publication9
Alternative sequenceiVSP_0221291271 – 1307GSYLP…NGNHG → EPYRETSMGVKLNIAYQIGA SEQCQGYKCHGYSTTEW in isoform 4 and isoform 5. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_0221301271 – 1284Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_0221311272 – 1350SYLPC…SNYIP → TMANHLMSNALLRPHGTNNP YNTLLGEPAVCNNPSISMYN AQEPYRETSMGVKLNIAYQI GASEQCQGYKCHGYSTTEW in isoform 6 and isoform 7. 1 PublicationAdd BLAST79
Alternative sequenceiVSP_0221321308 – 1550Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST243
Alternative sequenceiVSP_0221331351 – 1550Missing in isoform 6 and isoform 7. 1 PublicationAdd BLAST200

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF081154 mRNA Translation: AAC62660.1
AF081155 mRNA Translation: AAC62661.1
AF081156 mRNA Translation: AAC62662.1
AF081157 mRNA Translation: AAC62663.1
AF081158 mRNA Translation: AAC62664.1
AF081159 mRNA Translation: AAC62665.1
AF063103 mRNA Translation: AAC77816.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T14327
T17186
T17187
T17188
T17198
T17199
T17200

NCBI Reference Sequences

More...
RefSeqi
NP_570835.1, NM_130822.1 [Q9Z173-1]

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
170641

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:170641

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF081154 mRNA Translation: AAC62660.1
AF081155 mRNA Translation: AAC62661.1
AF081156 mRNA Translation: AAC62662.1
AF081157 mRNA Translation: AAC62663.1
AF081158 mRNA Translation: AAC62664.1
AF081159 mRNA Translation: AAC62665.1
AF063103 mRNA Translation: AAC77816.1
PIRiT14327
T17186
T17187
T17188
T17198
T17199
T17200
RefSeqiNP_570835.1, NM_130822.1 [Q9Z173-1]

3D structure databases

SMRiQ9Z173
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi250970, 1 interactor
STRINGi10116.ENSRNOP00000056687

Chemistry databases

GuidetoPHARMACOLOGYi208

Protein family/group databases

MEROPSiP02.011

Information system for G protein-coupled receptors (GPCRs)

More...
GPCRDBi
Search...

PTM databases

GlyGeniQ9Z173, 8 sites
iPTMnetiQ9Z173
PhosphoSitePlusiQ9Z173

Proteomic databases

PaxDbiQ9Z173
PRIDEiQ9Z173

Genome annotation databases

GeneIDi170641
KEGGirno:170641

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23284
RGDi620836, Adgrl3

Phylogenomic databases

eggNOGiKOG3545, Eukaryota
KOG4193, Eukaryota
KOG4729, Eukaryota
InParanoidiQ9Z173
OrthoDBi388923at2759
PhylomeDBiQ9Z173

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9Z173

Family and domain databases

Gene3Di2.60.120.740, 1 hit
4.10.1240.10, 1 hit
InterProiView protein in InterPro
IPR032471, GAIN_dom_N
IPR017981, GPCR_2-like
IPR036445, GPCR_2_extracell_dom_sf
IPR001879, GPCR_2_extracellular_dom
IPR003924, GPCR_2_latrophilin
IPR003334, GPCR_2_latrophilin_rcpt_C
IPR000832, GPCR_2_secretin-like
IPR017983, GPCR_2_secretin-like_CS
IPR000203, GPS
IPR015630, Latrophilin-3
IPR000922, Lectin_gal-bd_dom
IPR043159, Lectin_gal-bd_sf
IPR003112, Olfac-like_dom
PANTHERiPTHR12011:SF60, PTHR12011:SF60, 1 hit
PfamiView protein in Pfam
PF00002, 7tm_2, 1 hit
PF16489, GAIN, 1 hit
PF02140, Gal_Lectin, 1 hit
PF01825, GPS, 1 hit
PF02354, Latrophilin, 2 hits
PF02191, OLF, 1 hit
PRINTSiPR00249, GPCRSECRETIN
PR01444, LATROPHILIN
SMARTiView protein in SMART
SM00303, GPS, 1 hit
SM00008, HormR, 1 hit
SM00284, OLF, 1 hit
PROSITEiView protein in PROSITE
PS00650, G_PROTEIN_RECEP_F2_2, 1 hit
PS50227, G_PROTEIN_RECEP_F2_3, 1 hit
PS50261, G_PROTEIN_RECEP_F2_4, 1 hit
PS50221, GPS, 1 hit
PS51132, OLF, 1 hit
PS50228, SUEL_LECTIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAGRL3_RAT
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Z173
Secondary accession number(s): O88924
, O88925, O88926, O88927, O88928, O88929, Q4LDM4, Q4LDM5, Q4LDM6, Q4LDM7, Q4LDM8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 9, 2007
Last sequence update: May 1, 1999
Last modified: April 7, 2021
This is version 122 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again