Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9Z0P7 (SUFU_MOUSE)

Entry version 154 (02 Dec 2020)
Sequence version 1 (01 May 1999)
Previous versions | rss
Add a publicationFeedback
Protein

Suppressor of fused homolog

Gene

Sufu

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Negative regulator in the hedgehog/smoothened signaling pathway (PubMed:16155214, PubMed:16459298). Down-regulates GLI1-mediated transactivation of target genes (PubMed:11960000). Part of a corepressor complex that acts on DNA-bound GLI1 (PubMed:11960000). May also act by linking GLI1 to BTRC and thereby targeting GLI1 to degradation by the proteasome (By similarity). Sequesters GLI1, GLI2 and GLI3 in the cytoplasm, this effect is overcome by binding of STK36 to both SUFU and a GLI protein (PubMed:10531011, PubMed:16459298). Negative regulator of beta-catenin signaling (PubMed:11477086). Regulates the formation of either the repressor form (GLI3R) or the activator form (GLI3A) of the full-length form of GLI3 (GLI3FL) (PubMed:10531011, PubMed:20360384). GLI3FL is complexed with SUFU in the cytoplasm and is maintained in a neutral state (PubMed:10531011, PubMed:20360384). Without the Hh signal, the SUFU-GLI3 complex is recruited to cilia, leading to the efficient processing of GLI3FL into GLI3R (PubMed:10531011, PubMed:20360384). When Hh signaling is initiated, SUFU dissociates from GLI3FL and the latter translocates to the nucleus, where it is phosphorylated, destabilized, and converted to a transcriptional activator (GLI3A) (PubMed:10531011, PubMed:20360384). Required for normal embryonic development (PubMed:16155214, PubMed:16459298). Required for the proper formation of hair follicles and the control of epidermal differentiation (PubMed:16155214, PubMed:16459298, PubMed:23034632).By similarity7 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-5610780, Degradation of GLI1 by the proteasome
R-MMU-5610785, GLI3 is processed to GLI3R by the proteasome
R-MMU-5610787, Hedgehog 'off' state
R-MMU-5632684, Hedgehog 'on' state

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Suppressor of fused homolog1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Sufu1 PublicationImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:1345643, Sufu

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Complete embryonic lethality at about 10.5 dpc due to defects in neural tube closure, abnormal somites and abnormal heart looping (PubMed:16155214, PubMed:16459298). Heterozygous mice are born at the expected Mendelian rate and are fertile. After 1.5 years, they develop a skin phenotype characterized by ventral alopecia, increased pigmentation, with papules and nodules on paws and tail (PubMed:16459298).2 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000723031 – 484Suppressor of fused homologAdd BLAST484

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki257Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)By similarity
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei301PhosphoserineBy similarity1
Modified residuei303N6-acetyllysineBy similarity1
Cross-linki321Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei342PhosphoserineBy similarity1
Modified residuei346PhosphoserineCombined sources1
Modified residuei352PhosphoserineBy similarity1
Modified residuei353PhosphothreonineBy similarity1
Modified residuei481PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Polyubiquitinated at Lys-257 by the SCF(FBXL17) complex, leading to its subsequent degradation and allowing the release of GLI1 for proper hedgehog/smoothened signal transduction. Ubiquitination is impaired by phosphorylation at Ser-342, Ser-346, Ser-352 and Thr-353.By similarity
Phosphorylation at Ser-342, Ser-346, Ser-352 and Thr-353 prevents ubiquitination by the SCF(FBXL17) complex.By similarity

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9Z0P7

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9Z0P7

PeptideAtlas

More...PeptideAtlasi		Q9Z0P7

PRoteomics IDEntifications database

More...PRIDEi		Q9Z0P7

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9Z0P7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9Z0P7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed in adult and fetal tissues.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000025231, Expressed in ear vesicle and 295 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9Z0P7, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9Z0P7, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

May form homodimers (By similarity).

Interacts with ULK3; inactivating the protein kinase activity of ULK3.

Interacts with RAB23 (By similarity).

Part of a DNA-bound corepressor complex containing SAP18, GLI1 and SIN3 (PubMed:11960000).

Part of a complex containing CTNNB1 (PubMed:11477086). Binds BTRC, GLI2, GLI3, SAP18 and STK36 (PubMed:20360384, PubMed:23034632). Binds both free and DNA-bound GLI1 (PubMed:10531011).

Interacts with KIF7 (PubMed:19592253).

Interacts with GLI3FL and this interaction regulates the formation of either repressor or activator forms of GLI3 (PubMed:20360384). Its association with GLI3FL is regulated by Hh signaling and dissociation of the SUFU-GLI3 interaction requires the presence of the ciliary motor KIF3A (PubMed:20360384).

By similarity6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		204881, 24 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-147, GLI1-SUFU complex
CPX-149, GLI2-SUFU complex
CPX-151, GLI3-SUFU complex

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q9Z0P7

Protein interaction database and analysis system

More...IntActi		Q9Z0P7, 21 interactors

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000107498

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9Z0P7, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9Z0P7

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni279 – 360Intrinsically disorderedBy similarityAdd BLAST82

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SUFU family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QT57, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000009747

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_033906_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9Z0P7

Identification of Orthologs from Complete Genome Data

More...OMAi		GDNIPWR

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9Z0P7

TreeFam database of animal gene trees

More...TreeFami		TF324548

Family and domain databases

Database of protein disorder

More...DisProti		DP01397

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.1360.230, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR020941, SUFU-like_domain
IPR024314, SUFU_C
IPR038489, SUFU_C_sf
IPR037181, SUFU_N
IPR007768, Suppressor_of_fused
IPR016591, Suppressor_of_fused_euk

The PANTHER Classification System

More...PANTHERi		PTHR10928, PTHR10928, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF05076, SUFU, 1 hit
PF12470, SUFU_C, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF011844, Suppressor_of_fused_protein, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF103359, SSF103359, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Z0P7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAELRPSVAP GPAAPPASGP SAPPAFASLF PPGLHAIYGE CRRLYPDQPN 
        60         70         80         90        100
PLQVTAIVKY WLGGPDPLDY VSMYRNMGSP SANIPEHWHY ISFGLSDLYG 
       110        120        130        140        150
DNRVHEFTGT DGPSGFGFEL TFRLKRETGE SAPPTWPAEL MQGLARYVFQ 
       160        170        180        190        200
SENTFCSGDH VSWHSPLDNS ESRIQHMLLT EDPQMQPVRT PFGVVTFLQI 
       210        220        230        240        250
VGVCTEELHS AQQWNGQGIL ELLRTVPIAG GPWLITDMRR GETIFEIDPH 
       260        270        280        290        300
LQERVDKGIE TDGSNLSGVS AKCAWDDLSR PPEDEEDSRS ICLGTQPRRL 
       310        320        330        340        350
SGKDTEQIRE TLRRGLEINS KPVLPPINSQ RQNGLTHDRA PSRKDSLGSD 
       360        370        380        390        400
SSTAIIPHEL IRTRQLESVH LKFNQESGAL IPLCLRGRLL HGRHFTYKSI 
       410        420        430        440        450
TGDMAITFVS TGVEGAFATE EHPYAAHGPW LQILLTEEFV EKMLEDLEDL 
       460        470        480 
TSPEEFKLPK EYSWPEKKLK VSILPDVVFD SPLH
Length:484
Mass (Da):53,957
Last modified:May 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6ED5666BC4D4AFB5
GO
Isoform 2 (identifier: Q9Z0P7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     62-106: Missing.
     252-252: Q → QQ

Show »
Length:440
Mass (Da):48,994
Checksum:i1C36B0D3382C1F95
GO
Isoform 3 (identifier: Q9Z0P7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     252-252: Q → QQ
     433-484: ILLTEEFVEK...PDVVFDSPLH → VRRSLSSFSSSSCSSLAACPPLPHHPKDRPLWLPC

Show »
Length:468
Mass (Da):51,759
Checksum:i98B0F3F09CA85B8A
GO
Isoform 4 (identifier: Q9Z0P7-4) [UniParc]FASTAAdd to basket
Also known as: SU(FU)-XL

The sequence of this isoform differs from the canonical sequence as follows:
     252-252: Q → QQ

Show »
Length:485
Mass (Da):54,085
Checksum:iF9387714357EC8E4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z7B6D3Z7B6_MOUSE
Suppressor of fused homolog
Sufu
467Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0R4J1M0A0A0R4J1M0_MOUSE
Suppressor of fused homolog
Sufu
297Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti79S → C in AAF61412 (PubMed:10531011).Curated1
Sequence conflicti220L → Q in AAF61412 (PubMed:10531011).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01328162 – 106Missing in isoform 2. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_013282252Q → QQ in isoform 2, isoform 3 and isoform 4. 2 Publications1
Alternative sequenceiVSP_013283433 – 484ILLTE…DSPLH → VRRSLSSFSSSSCSSLAACP PLPHHPKDRPLWLPC in isoform 3. 1 PublicationAdd BLAST52

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF134893 mRNA Translation: AAF61412.1
AJ131692 mRNA Translation: CAB38081.1
AJ308625 mRNA Translation: CAC34257.1
AJ308626 mRNA Translation: CAC34258.1
AJ308627 AJ308631 Genomic DNA Translation: CAC34271.1
AK015885 mRNA Translation: BAB30017.1
AK047603 mRNA Translation: BAC33095.1
BC048168 mRNA Translation: AAH48168.1
BC056997 mRNA Translation: AAH56997.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS29879.1 [Q9Z0P7-1]
CCDS38008.1 [Q9Z0P7-4]

NCBI Reference Sequences

More...RefSeqi		NP_001020562.1, NM_001025391.2 [Q9Z0P7-1]
NP_056567.2, NM_015752.3 [Q9Z0P7-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000039922; ENSMUSP00000049109; ENSMUSG00000025231 [Q9Z0P7-1]
ENSMUST00000111867; ENSMUSP00000107498; ENSMUSG00000025231 [Q9Z0P7-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		24069

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:24069

UCSC genome browser

More...UCSCi		uc008htn.2, mouse [Q9Z0P7-2]
uc008hto.2, mouse [Q9Z0P7-3]
uc008htq.2, mouse [Q9Z0P7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF134893 mRNA Translation: AAF61412.1
AJ131692 mRNA Translation: CAB38081.1
AJ308625 mRNA Translation: CAC34257.1
AJ308626 mRNA Translation: CAC34258.1
AJ308627 AJ308631 Genomic DNA Translation: CAC34271.1
AK015885 mRNA Translation: BAB30017.1
AK047603 mRNA Translation: BAC33095.1
BC048168 mRNA Translation: AAH48168.1
BC056997 mRNA Translation: AAH56997.1
CCDSiCCDS29879.1 [Q9Z0P7-1]
CCDS38008.1 [Q9Z0P7-4]
RefSeqiNP_001020562.1, NM_001025391.2 [Q9Z0P7-1]
NP_056567.2, NM_015752.3 [Q9Z0P7-4]

3D structure databases

SMRiQ9Z0P7
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi204881, 24 interactors
ComplexPortaliCPX-147, GLI1-SUFU complex
CPX-149, GLI2-SUFU complex
CPX-151, GLI3-SUFU complex
CORUMiQ9Z0P7
IntActiQ9Z0P7, 21 interactors
STRINGi10090.ENSMUSP00000107498

PTM databases

iPTMnetiQ9Z0P7
PhosphoSitePlusiQ9Z0P7

Proteomic databases

jPOSTiQ9Z0P7
PaxDbiQ9Z0P7
PeptideAtlasiQ9Z0P7
PRIDEiQ9Z0P7

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1768, 276 antibodies

Genome annotation databases

EnsembliENSMUST00000039922; ENSMUSP00000049109; ENSMUSG00000025231 [Q9Z0P7-1]
ENSMUST00000111867; ENSMUSP00000107498; ENSMUSG00000025231 [Q9Z0P7-4]
GeneIDi24069
KEGGimmu:24069
UCSCiuc008htn.2, mouse [Q9Z0P7-2]
uc008hto.2, mouse [Q9Z0P7-3]
uc008htq.2, mouse [Q9Z0P7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		51684
MGIiMGI:1345643, Sufu

Phylogenomic databases

eggNOGiENOG502QT57, Eukaryota
GeneTreeiENSGT00390000009747
HOGENOMiCLU_033906_0_0_1
InParanoidiQ9Z0P7
OMAiGDNIPWR
PhylomeDBiQ9Z0P7
TreeFamiTF324548

Enzyme and pathway databases

ReactomeiR-MMU-5610780, Degradation of GLI1 by the proteasome
R-MMU-5610785, GLI3 is processed to GLI3R by the proteasome
R-MMU-5610787, Hedgehog 'off' state
R-MMU-5632684, Hedgehog 'on' state

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		24069, 6 hits in 20 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Sufu, mouse

Protein Ontology

More...PROi		PR:Q9Z0P7
RNActiQ9Z0P7, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000025231, Expressed in ear vesicle and 295 other tissues
ExpressionAtlasiQ9Z0P7, baseline and differential
GenevisibleiQ9Z0P7, MM

Family and domain databases

DisProtiDP01397
Gene3Di3.30.1360.230, 1 hit
InterProiView protein in InterPro
IPR020941, SUFU-like_domain
IPR024314, SUFU_C
IPR038489, SUFU_C_sf
IPR037181, SUFU_N
IPR007768, Suppressor_of_fused
IPR016591, Suppressor_of_fused_euk
PANTHERiPTHR10928, PTHR10928, 1 hit
PfamiView protein in Pfam
PF05076, SUFU, 1 hit
PF12470, SUFU_C, 1 hit
PIRSFiPIRSF011844, Suppressor_of_fused_protein, 1 hit
SUPFAMiSSF103359, SSF103359, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSUFU_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Z0P7
Secondary accession number(s): Q8C8B4
, Q99JG0, Q9D521, Q9JLU1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 29, 2005
Last sequence update: May 1, 1999
Last modified: December 2, 2020
This is version 154 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again