Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 109 (05 Jun 2019)
Sequence version 1 (01 May 1999)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

WAS/WASL-interacting protein family member 3

Gene

Wipf3

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May have a role in spermatogenesis (By similarity). May be a regulator of cytoskeletal organization.By similarity1 Publication

Miscellaneous

Suppress the growth and endocytosis defect of yeast lacking VRP1 without correcting the actin patch polarization defect.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • actin filament binding Source: GO_Central
  • SH3 domain binding Source: RGD

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding, Developmental protein
Biological processDifferentiation, Spermatogenesis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-RNO-2029482 Regulation of actin dynamics for phagocytic cup formation
R-RNO-5663213 RHO GTPases Activate WASPs and WAVEs

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
WAS/WASL-interacting protein family member 3
Alternative name(s):
Corticosteroids and regional expression protein 16
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Wipf3
Synonyms:Cr16
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Rat genome database

More...
RGDi
708559 Wipf3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi58 – 61RLRK → AAAA: Does not abolish the ability to suppress the growth defect of yeast lacking VRP1. 1 Publication4

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003379991 – 485WAS/WASL-interacting protein family member 3Add BLAST485

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei46Asymmetric dimethylarginineBy similarity1
Modified residuei150PhosphoserineCombined sources1
Modified residuei208PhosphoserineBy similarity1
Modified residuei394PhosphoserineBy similarity1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Z0G8

PRoteomics IDEntifications database

More...
PRIDEi
Q9Z0G8

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Z0G8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Z0G8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected mainly in brain and at lower levels in heart and lung (at protein level). Also detected in testis but not in kidney, liver or spleen.2 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By aldosterone, corticosterone and RU28362 in hyppocampus. By corticosterone and RU28362 in cortex. The response to corticosterone is slow. Does not respond to vibratory stress. May be regulated by both the mineralocorticoid receptor and glucocorticoid receptor.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSRNOG00000009571 Expressed in 9 organ(s), highest expression level in Ammon's horn

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Z0G8 RN

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Isoform 1 interacts with WASL (via WH1 domain), and monomeric and filamentous actin.

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9Z0G8

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q9Z0G8

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000012747

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Z0G8

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini45 – 62WH2PROSITE-ProRule annotationAdd BLAST18

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi3 – 8Profilin-binding motif6
Motifi11 – 16Profilin-binding motif6
Motifi20 – 25Profilin-binding motif6
Motifi58 – 61RLRK4
Motifi426 – 450WASP-binding motifAdd BLAST25

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi173 – 178Poly-Pro6
Compositional biasi181 – 198Poly-ProAdd BLAST18
Compositional biasi229 – 243Poly-ProAdd BLAST15
Compositional biasi293 – 312Poly-ProAdd BLAST20
Compositional biasi325 – 331Poly-Pro7

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The WH2 domain is found in a number of putative actin-binding proteins.1 Publication
The profilin-binding motif has been implicated in the interaction with profilin and SH3 domains.1 Publication
The KLKR motif is essential for G-actin binding and for actin polymerization.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the verprolin family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410J09R Eukaryota
ENOG410Y0AH LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160267

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000090003

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Z0G8

KEGG Orthology (KO)

More...
KOi
K19475

Identification of Orthologs from Complete Genome Data

More...
OMAi
PFNPPAS

Database of Orthologous Groups

More...
OrthoDBi
1265175at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Z0G8

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003124 WH2_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02205 WH2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00246 WH2, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51082 WH2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9Z0G8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPVPPPPPPP LPPPPPPLGA PPPPPPPGPP ISTDAPSLRK SDLKGRSALL
60 70 80 90 100
ADIQQGTRLR KVTQINDRSA PQIESSKGTS KEGGAAGSNA RGGSTPPALG
110 120 130 140 150
DLFAGGFPVL RPAGQRDVAG GKTGQGPGSR APSPRLPTKA ISGPLPAPAS
160 170 180 190 200
PRLGNASDTH SSARPVPPRP SVPAPPPPTT PPPPPPPPPP PPPPPLPPAS
210 220 230 240 250
PIKAPSVSPP VPPTKGNPSA VPAPIPCVPP LPPPPPTPPP LPPASALSEK
260 270 280 290 300
AVRPQLAPLH LPPIPPPLPL LPPYGYPALH SEPSSPAQDV REPPAPPPPP
310 320 330 340 350
PPPPPPPPPP LPTYASCSPR AAVAPPPPPL PGSSNSGSET PPPLPPKSPS
360 370 380 390 400
FQTQKALPTP PGAPGPQIIL QKKRRGPGAG GGKLNPPPAP PARSPTTELS
410 420 430 440 450
SKTQQPGGQL RNGGQHVIDD FESKFTFHSM EDFPPPDEYK PGQKIYPSKV
460 470 480
PRSRTPGSWL QAEAAGQSSD DIKTRNSQLS LKALR
Length:485
Mass (Da):49,381
Last modified:May 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i195673E854CB37D9
GO
Isoform 2 (identifier: Q9Z0G8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     419-453: DDFESKFTFHSMEDFPPPDEYKPGQKIYPSKVPRS → G

Show »
Length:451
Mass (Da):45,308
Checksum:i6E2B50D1876E9CEE
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_034031419 – 453DDFES…KVPRS → G in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U25281 mRNA Translation: AAA87791.1
U31159 mRNA Translation: AAC99858.1
U31168
, U31161, U31162, U31163, U31164, U31165, U31166, U31167 Genomic DNA Translation: AAC99859.1

NCBI Reference Sequences

More...
RefSeqi
NP_671744.1, NM_147211.1 [Q9Z0G8-2]
XP_008761099.1, XM_008762877.2 [Q9Z0G8-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSRNOT00000012755; ENSRNOP00000012755; ENSRNOG00000009571 [Q9Z0G8-2]
ENSRNOT00000074054; ENSRNOP00000064597; ENSRNOG00000009571 [Q9Z0G8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
259242

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:259242

UCSC genome browser

More...
UCSCi
RGD:708559 rat [Q9Z0G8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U25281 mRNA Translation: AAA87791.1
U31159 mRNA Translation: AAC99858.1
U31168
, U31161, U31162, U31163, U31164, U31165, U31166, U31167 Genomic DNA Translation: AAC99859.1
RefSeqiNP_671744.1, NM_147211.1 [Q9Z0G8-2]
XP_008761099.1, XM_008762877.2 [Q9Z0G8-1]

3D structure databases

SMRiQ9Z0G8
ModBaseiSearch...

Protein-protein interaction databases

CORUMiQ9Z0G8
ELMiQ9Z0G8
STRINGi10116.ENSRNOP00000012747

PTM databases

iPTMnetiQ9Z0G8
PhosphoSitePlusiQ9Z0G8

Proteomic databases

PaxDbiQ9Z0G8
PRIDEiQ9Z0G8

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000012755; ENSRNOP00000012755; ENSRNOG00000009571 [Q9Z0G8-2]
ENSRNOT00000074054; ENSRNOP00000064597; ENSRNOG00000009571 [Q9Z0G8-1]
GeneIDi259242
KEGGirno:259242
UCSCiRGD:708559 rat [Q9Z0G8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
644150
RGDi708559 Wipf3

Phylogenomic databases

eggNOGiENOG410J09R Eukaryota
ENOG410Y0AH LUCA
GeneTreeiENSGT00940000160267
HOGENOMiHOG000090003
InParanoidiQ9Z0G8
KOiK19475
OMAiPFNPPAS
OrthoDBi1265175at2759
PhylomeDBiQ9Z0G8

Enzyme and pathway databases

ReactomeiR-RNO-2029482 Regulation of actin dynamics for phagocytic cup formation
R-RNO-5663213 RHO GTPases Activate WASPs and WAVEs

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9Z0G8

Gene expression databases

BgeeiENSRNOG00000009571 Expressed in 9 organ(s), highest expression level in Ammon's horn
GenevisibleiQ9Z0G8 RN

Family and domain databases

InterProiView protein in InterPro
IPR003124 WH2_dom
PfamiView protein in Pfam
PF02205 WH2, 1 hit
SMARTiView protein in SMART
SM00246 WH2, 1 hit
PROSITEiView protein in PROSITE
PS51082 WH2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiWIPF3_RAT
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Z0G8
Secondary accession number(s): Q62775
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: May 1, 1999
Last modified: June 5, 2019
This is version 109 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again