Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 151 (22 Apr 2020)
Sequence version 1 (01 Nov 1999)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ribosomal protein S6 kinase-like 1

Gene

RPS6KL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei177ATPPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei412Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi151 – 159ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Ribonucleoprotein, Ribosomal protein, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9Y6S9

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ribosomal protein S6 kinase-like 1 (EC:2.7.11.1)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RPS6KL1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:20222 RPS6KL1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y6S9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000198208

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134868364

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9Y6S9 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RPS6KL1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74762793

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002326411 – 549Ribosomal protein S6 kinase-like 1Add BLAST549

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9Y6S9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9Y6S9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y6S9

PeptideAtlas

More...
PeptideAtlasi
Q9Y6S9

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y6S9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
86783 [Q9Y6S9-1]
86784 [Q9Y6S9-2]
86785 [Q9Y6S9-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y6S9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y6S9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000198208 Expressed in right hemisphere of cerebellum and 126 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9Y6S9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Y6S9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000198208 Tissue enhanced (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123728, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q9Y6S9, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000346644

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9Y6S9 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini87 – 115MITAdd BLAST29
Domaini145 – 539Protein kinasePROSITE-ProRule annotationAdd BLAST395

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. S6 kinase subfamily.PROSITE-ProRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0603 Eukaryota
ENOG410ZH1N LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159815

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_014272_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y6S9

KEGG Orthology (KO)

More...
KOi
K20839

Identification of Orthologs from Complete Genome Data

More...
OMAi
HPGQLEL

Database of Orthologous Groups

More...
OrthoDBi
255297at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y6S9

TreeFam database of animal gene trees

More...
TreeFami
TF323964

Family and domain databases

Conserved Domains Database

More...
CDDi
cd05576 STKc_RPK118_like, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR007330 MIT
IPR036181 MIT_dom_sf
IPR000719 Prot_kinase_dom
IPR035050 RPS6KL1
IPR035053 STK_RPK118-like

The PANTHER Classification System

More...
PANTHERi
PTHR15508:SF4 PTHR15508:SF4, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04212 MIT, 1 hit
PF00069 Pkinase, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00745 MIT, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF116846 SSF116846, 1 hit
SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y6S9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSLVACECLP SPGLEPEPCS RARSQAHVYL EQIRNRVALG VPDMTKRDYL
60 70 80 90 100
VDAATQIRLA LERDVSEDYE AAFNHYQNGV DVLLRGIHVD PNKERREAVK
110 120 130 140 150
LKITKYLRRA EEIFNCHLQR PLSSGASPSA GFSSLRLRPI RTLSSAVEQL
160 170 180 190 200
RGCRVVGVIE KVQLVQDPAT GGTFVVKSLP RCHMVSRERL TIIPHGVPYM
210 220 230 240 250
TKLLRYFVSE DSIFLHLEHV QGGTLWSHLL SQAHSRHSGL SSGSTQERMK
260 270 280 290 300
AQLNPHLNLL TPARLPSGHA PGQDRIALEP PRTSPNLLLA GEAPSTRPQR
310 320 330 340 350
EAEGEPTART STSGSSDLPK APGGHLHLQA RRAGQNSDAG PPRGLTWVPE
360 370 380 390 400
GAGPVLGGCG RGMDQSCLSA DGAGRGCGRA TWSVREEQVK QWAAEMLVAL
410 420 430 440 450
EALHEQGVLC RDLHPGNLLL DQAGHIRLTY FGQWSEVEPQ CCGEAVDNLY
460 470 480 490 500
SAPEVGGISE LTEACDWWSF GSLLYELLTG MALSQSHPSG IQAHTQLQLP
510 520 530 540
EWLSRPAASL LTELLQFEPT RRLGMGEGGV SKLKSHPFFS TIQWSKLVG
Length:549
Mass (Da):60,036
Last modified:November 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC5955B004EAC959A
GO
Isoform 2 (identifier: Q9Y6S9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     131-161: Missing.
     549-549: G → GTSLETHLRTLIHWLSGPKPDCPG

Show »
Length:541
Mass (Da):59,167
Checksum:i88C9760751DFCDA9
GO
Isoform 4 (identifier: Q9Y6S9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     223-255: GTLWSHLLSQAHSRHSGLSSGSTQERMKAQLNP → EQAWGPLSAPQAFGVCRQPLKCGALAGRGGSRL
     256-549: Missing.

Show »
Length:255
Mass (Da):28,380
Checksum:i692BAFB709865749
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YJ58H0YJ58_HUMAN
Ribosomal protein S6 kinase-like 1
RPS6KL1
157Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJB8H0YJB8_HUMAN
Ribosomal protein S6 kinase-like 1
RPS6KL1
104Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJM5H0YJM5_HUMAN
Ribosomal protein S6 kinase-like 1
RPS6KL1
74Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJ80H0YJ80_HUMAN
Ribosomal protein S6 kinase-like 1
RPS6KL1
45Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJR0H0YJR0_HUMAN
Ribosomal protein S6 kinase-like 1
RPS6KL1
48Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JL89A0A0G2JL89_HUMAN
Ribosomal protein S6 kinase-like 1
RPS6KL1
8Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti64D → G in BAB70808 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04106521R → Q1 PublicationCorresponds to variant dbSNP:rs7156590Ensembl.1
Natural variantiVAR_041066121P → L1 PublicationCorresponds to variant dbSNP:rs2286913Ensembl.1
Natural variantiVAR_041067332R → W1 PublicationCorresponds to variant dbSNP:rs55871101Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_036440131 – 161Missing in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_017931223 – 255GTLWS…AQLNP → EQAWGPLSAPQAFGVCRQPL KCGALAGRGGSRL in isoform 4. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_017932256 – 549Missing in isoform 4. 1 PublicationAdd BLAST294
Alternative sequenceiVSP_036441549G → GTSLETHLRTLIHWLSGPKP DCPG in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK054800 mRNA Translation: BAB70808.1
AC006530 Genomic DNA Translation: AAD30182.1
BC004540 mRNA Translation: AAH04540.1
AL390152 mRNA Translation: CAH10661.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS9834.2 [Q9Y6S9-1]

NCBI Reference Sequences

More...
RefSeqi
NP_113652.2, NM_031464.4 [Q9Y6S9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000354625; ENSP00000346644; ENSG00000198208 [Q9Y6S9-1]
ENST00000555009; ENSP00000450660; ENSG00000198208 [Q9Y6S9-2]
ENST00000555647; ENSP00000452027; ENSG00000198208 [Q9Y6S9-1]
ENST00000557413; ENSP00000450567; ENSG00000198208 [Q9Y6S9-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
83694

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:83694

UCSC genome browser

More...
UCSCi
uc010tux.3 human [Q9Y6S9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK054800 mRNA Translation: BAB70808.1
AC006530 Genomic DNA Translation: AAD30182.1
BC004540 mRNA Translation: AAH04540.1
AL390152 mRNA Translation: CAH10661.1
CCDSiCCDS9834.2 [Q9Y6S9-1]
RefSeqiNP_113652.2, NM_031464.4 [Q9Y6S9-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi123728, 3 interactors
IntActiQ9Y6S9, 1 interactor
STRINGi9606.ENSP00000346644

PTM databases

iPTMnetiQ9Y6S9
PhosphoSitePlusiQ9Y6S9

Polymorphism and mutation databases

BioMutaiRPS6KL1
DMDMi74762793

Proteomic databases

EPDiQ9Y6S9
MassIVEiQ9Y6S9
PaxDbiQ9Y6S9
PeptideAtlasiQ9Y6S9
PRIDEiQ9Y6S9
ProteomicsDBi86783 [Q9Y6S9-1]
86784 [Q9Y6S9-2]
86785 [Q9Y6S9-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
25730 177 antibodies

The DNASU plasmid repository

More...
DNASUi
83694

Genome annotation databases

EnsembliENST00000354625; ENSP00000346644; ENSG00000198208 [Q9Y6S9-1]
ENST00000555009; ENSP00000450660; ENSG00000198208 [Q9Y6S9-2]
ENST00000555647; ENSP00000452027; ENSG00000198208 [Q9Y6S9-1]
ENST00000557413; ENSP00000450567; ENSG00000198208 [Q9Y6S9-1]
GeneIDi83694
KEGGihsa:83694
UCSCiuc010tux.3 human [Q9Y6S9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
83694

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RPS6KL1
HGNCiHGNC:20222 RPS6KL1
HPAiENSG00000198208 Tissue enhanced (brain)
neXtProtiNX_Q9Y6S9
OpenTargetsiENSG00000198208
PharmGKBiPA134868364

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0603 Eukaryota
ENOG410ZH1N LUCA
GeneTreeiENSGT00940000159815
HOGENOMiCLU_014272_2_0_1
InParanoidiQ9Y6S9
KOiK20839
OMAiHPGQLEL
OrthoDBi255297at2759
PhylomeDBiQ9Y6S9
TreeFamiTF323964

Enzyme and pathway databases

SignaLinkiQ9Y6S9

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
83694
PharosiQ9Y6S9 Tdark

Protein Ontology

More...
PROi
PR:Q9Y6S9
RNActiQ9Y6S9 protein

Gene expression databases

BgeeiENSG00000198208 Expressed in right hemisphere of cerebellum and 126 other tissues
ExpressionAtlasiQ9Y6S9 baseline and differential
GenevisibleiQ9Y6S9 HS

Family and domain databases

CDDicd05576 STKc_RPK118_like, 1 hit
InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR007330 MIT
IPR036181 MIT_dom_sf
IPR000719 Prot_kinase_dom
IPR035050 RPS6KL1
IPR035053 STK_RPK118-like
PANTHERiPTHR15508:SF4 PTHR15508:SF4, 1 hit
PfamiView protein in Pfam
PF04212 MIT, 1 hit
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00745 MIT, 1 hit
SUPFAMiSSF116846 SSF116846, 1 hit
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRPKL1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y6S9
Secondary accession number(s): A6NGM9
, Q69YT9, Q6ZMQ6, Q96NR9, Q9BSU9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 18, 2006
Last sequence update: November 1, 1999
Last modified: April 22, 2020
This is version 151 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again