Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ribosomal protein S6 kinase-like 1

Gene

RPS6KL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei177ATPPROSITE-ProRule annotation1
Active sitei412Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi151 – 159ATPPROSITE-ProRule annotation9

GO - Molecular functioni

Keywordsi

Molecular functionKinase, Ribonucleoprotein, Ribosomal protein, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLinkiQ9Y6S9

Names & Taxonomyi

Protein namesi
Recommended name:
Ribosomal protein S6 kinase-like 1 (EC:2.7.11.1)
Gene namesi
Name:RPS6KL1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

EuPathDBiHostDB:ENSG00000198208.11
HGNCiHGNC:20222 RPS6KL1
neXtProtiNX_Q9Y6S9

Subcellular locationi

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000198208
PharmGKBiPA134868364

Polymorphism and mutation databases

BioMutaiRPS6KL1
DMDMi74762793

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002326411 – 549Ribosomal protein S6 kinase-like 1Add BLAST549

Proteomic databases

EPDiQ9Y6S9
PaxDbiQ9Y6S9
PeptideAtlasiQ9Y6S9
PRIDEiQ9Y6S9
ProteomicsDBi86783
86784 [Q9Y6S9-2]
86785 [Q9Y6S9-4]

PTM databases

iPTMnetiQ9Y6S9
PhosphoSitePlusiQ9Y6S9

Expressioni

Gene expression databases

BgeeiENSG00000198208 Expressed in 127 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_RPS6KL1
ExpressionAtlasiQ9Y6S9 baseline and differential
GenevisibleiQ9Y6S9 HS

Organism-specific databases

HPAiHPA027451
HPA027794

Interactioni

Protein-protein interaction databases

BioGridi123728, 3 interactors
IntActiQ9Y6S9, 1 interactor

Structurei

3D structure databases

ProteinModelPortaliQ9Y6S9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini87 – 115MITAdd BLAST29
Domaini145 – 539Protein kinasePROSITE-ProRule annotationAdd BLAST395

Sequence similaritiesi

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. S6 kinase subfamily.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0603 Eukaryota
ENOG410ZH1N LUCA
GeneTreeiENSGT00890000139413
HOGENOMiHOG000154183
HOVERGENiHBG084136
InParanoidiQ9Y6S9
KOiK20839
OMAiPQCCREA
OrthoDBiEOG091G0CNL
PhylomeDBiQ9Y6S9
TreeFamiTF323964

Family and domain databases

CDDicd05576 STKc_RPK118_like, 1 hit
InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR007330 MIT
IPR036181 MIT_dom_sf
IPR000719 Prot_kinase_dom
IPR035050 RPS6KL1
IPR035053 STK_RPK118-like
PANTHERiPTHR15508:SF4 PTHR15508:SF4, 1 hit
PfamiView protein in Pfam
PF04212 MIT, 1 hit
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00745 MIT, 1 hit
SUPFAMiSSF116846 SSF116846, 1 hit
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y6S9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSLVACECLP SPGLEPEPCS RARSQAHVYL EQIRNRVALG VPDMTKRDYL
60 70 80 90 100
VDAATQIRLA LERDVSEDYE AAFNHYQNGV DVLLRGIHVD PNKERREAVK
110 120 130 140 150
LKITKYLRRA EEIFNCHLQR PLSSGASPSA GFSSLRLRPI RTLSSAVEQL
160 170 180 190 200
RGCRVVGVIE KVQLVQDPAT GGTFVVKSLP RCHMVSRERL TIIPHGVPYM
210 220 230 240 250
TKLLRYFVSE DSIFLHLEHV QGGTLWSHLL SQAHSRHSGL SSGSTQERMK
260 270 280 290 300
AQLNPHLNLL TPARLPSGHA PGQDRIALEP PRTSPNLLLA GEAPSTRPQR
310 320 330 340 350
EAEGEPTART STSGSSDLPK APGGHLHLQA RRAGQNSDAG PPRGLTWVPE
360 370 380 390 400
GAGPVLGGCG RGMDQSCLSA DGAGRGCGRA TWSVREEQVK QWAAEMLVAL
410 420 430 440 450
EALHEQGVLC RDLHPGNLLL DQAGHIRLTY FGQWSEVEPQ CCGEAVDNLY
460 470 480 490 500
SAPEVGGISE LTEACDWWSF GSLLYELLTG MALSQSHPSG IQAHTQLQLP
510 520 530 540
EWLSRPAASL LTELLQFEPT RRLGMGEGGV SKLKSHPFFS TIQWSKLVG
Note: No experimental confirmation available.
Length:549
Mass (Da):60,036
Last modified:November 1, 1999 - v1
Checksum:iC5955B004EAC959A
GO
Isoform 2 (identifier: Q9Y6S9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     131-161: Missing.
     549-549: G → GTSLETHLRTLIHWLSGPKPDCPG

Note: No experimental confirmation available.
Show »
Length:541
Mass (Da):59,167
Checksum:i88C9760751DFCDA9
GO
Isoform 4 (identifier: Q9Y6S9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     223-255: GTLWSHLLSQAHSRHSGLSSGSTQERMKAQLNP → EQAWGPLSAPQAFGVCRQPLKCGALAGRGGSRL
     256-549: Missing.

Note: No experimental confirmation available.
Show »
Length:255
Mass (Da):28,380
Checksum:i692BAFB709865749
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YJ58H0YJ58_HUMAN
Ribosomal protein S6 kinase-like 1
RPS6KL1
157Annotation score:
H0YJM5H0YJM5_HUMAN
Ribosomal protein S6 kinase-like 1
RPS6KL1
74Annotation score:
H0YJB8H0YJB8_HUMAN
Ribosomal protein S6 kinase-like 1
RPS6KL1
104Annotation score:
H0YJR0H0YJR0_HUMAN
Ribosomal protein S6 kinase-like 1
RPS6KL1
48Annotation score:
H0YJ80H0YJ80_HUMAN
Ribosomal protein S6 kinase-like 1
RPS6KL1
45Annotation score:
A0A0G2JL89A0A0G2JL89_HUMAN
Ribosomal protein S6 kinase-like 1
RPS6KL1
8Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti64D → G in BAB70808 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04106521R → Q1 PublicationCorresponds to variant dbSNP:rs7156590Ensembl.1
Natural variantiVAR_041066121P → L1 PublicationCorresponds to variant dbSNP:rs2286913Ensembl.1
Natural variantiVAR_041067332R → W1 PublicationCorresponds to variant dbSNP:rs55871101Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_036440131 – 161Missing in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_017931223 – 255GTLWS…AQLNP → EQAWGPLSAPQAFGVCRQPL KCGALAGRGGSRL in isoform 4. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_017932256 – 549Missing in isoform 4. 1 PublicationAdd BLAST294
Alternative sequenceiVSP_036441549G → GTSLETHLRTLIHWLSGPKP DCPG in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK054800 mRNA Translation: BAB70808.1
AC006530 Genomic DNA Translation: AAD30182.1
BC004540 mRNA Translation: AAH04540.1
AL390152 mRNA Translation: CAH10661.1
CCDSiCCDS9834.2 [Q9Y6S9-1]
RefSeqiNP_113652.2, NM_031464.4 [Q9Y6S9-1]
UniGeneiHs.414481

Genome annotation databases

EnsembliENST00000354625; ENSP00000346644; ENSG00000198208 [Q9Y6S9-1]
ENST00000555009; ENSP00000450660; ENSG00000198208 [Q9Y6S9-2]
ENST00000555647; ENSP00000452027; ENSG00000198208 [Q9Y6S9-1]
ENST00000557413; ENSP00000450567; ENSG00000198208 [Q9Y6S9-1]
GeneIDi83694
KEGGihsa:83694
UCSCiuc010tux.3 human [Q9Y6S9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK054800 mRNA Translation: BAB70808.1
AC006530 Genomic DNA Translation: AAD30182.1
BC004540 mRNA Translation: AAH04540.1
AL390152 mRNA Translation: CAH10661.1
CCDSiCCDS9834.2 [Q9Y6S9-1]
RefSeqiNP_113652.2, NM_031464.4 [Q9Y6S9-1]
UniGeneiHs.414481

3D structure databases

ProteinModelPortaliQ9Y6S9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123728, 3 interactors
IntActiQ9Y6S9, 1 interactor

PTM databases

iPTMnetiQ9Y6S9
PhosphoSitePlusiQ9Y6S9

Polymorphism and mutation databases

BioMutaiRPS6KL1
DMDMi74762793

Proteomic databases

EPDiQ9Y6S9
PaxDbiQ9Y6S9
PeptideAtlasiQ9Y6S9
PRIDEiQ9Y6S9
ProteomicsDBi86783
86784 [Q9Y6S9-2]
86785 [Q9Y6S9-4]

Protocols and materials databases

DNASUi83694
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000354625; ENSP00000346644; ENSG00000198208 [Q9Y6S9-1]
ENST00000555009; ENSP00000450660; ENSG00000198208 [Q9Y6S9-2]
ENST00000555647; ENSP00000452027; ENSG00000198208 [Q9Y6S9-1]
ENST00000557413; ENSP00000450567; ENSG00000198208 [Q9Y6S9-1]
GeneIDi83694
KEGGihsa:83694
UCSCiuc010tux.3 human [Q9Y6S9-1]

Organism-specific databases

CTDi83694
EuPathDBiHostDB:ENSG00000198208.11
GeneCardsiRPS6KL1
H-InvDBiHIX0202061
HGNCiHGNC:20222 RPS6KL1
HPAiHPA027451
HPA027794
neXtProtiNX_Q9Y6S9
OpenTargetsiENSG00000198208
PharmGKBiPA134868364
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0603 Eukaryota
ENOG410ZH1N LUCA
GeneTreeiENSGT00890000139413
HOGENOMiHOG000154183
HOVERGENiHBG084136
InParanoidiQ9Y6S9
KOiK20839
OMAiPQCCREA
OrthoDBiEOG091G0CNL
PhylomeDBiQ9Y6S9
TreeFamiTF323964

Enzyme and pathway databases

SignaLinkiQ9Y6S9

Miscellaneous databases

GenomeRNAii83694
PROiPR:Q9Y6S9

Gene expression databases

BgeeiENSG00000198208 Expressed in 127 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_RPS6KL1
ExpressionAtlasiQ9Y6S9 baseline and differential
GenevisibleiQ9Y6S9 HS

Family and domain databases

CDDicd05576 STKc_RPK118_like, 1 hit
InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR007330 MIT
IPR036181 MIT_dom_sf
IPR000719 Prot_kinase_dom
IPR035050 RPS6KL1
IPR035053 STK_RPK118-like
PANTHERiPTHR15508:SF4 PTHR15508:SF4, 1 hit
PfamiView protein in Pfam
PF04212 MIT, 1 hit
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00745 MIT, 1 hit
SUPFAMiSSF116846 SSF116846, 1 hit
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRPKL1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y6S9
Secondary accession number(s): A6NGM9
, Q69YT9, Q6ZMQ6, Q96NR9, Q9BSU9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 18, 2006
Last sequence update: November 1, 1999
Last modified: November 7, 2018
This is version 141 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again