Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Roundabout homolog 1

Gene

ROBO1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor for SLIT1 and SLIT2 that mediates cellular responses to molecular guidance cues in cellular migration, including axonal navigation at the ventral midline of the neural tube and projection of axons to different regions during neuronal development (PubMed:10102268, PubMed:24560577). Interaction with the intracellular domain of FLRT3 mediates axon attraction towards cells expressing NTN1 (PubMed:24560577). In axon growth cones, the silencing of the attractive effect of NTN1 by SLIT2 may require the formation of a ROBO1-DCC complex (By similarity). Plays a role in the regulation of cell migration via its interaction with MYO9B; inhibits MYO9B-mediated stimulation of RHOA GTPase activity, and thereby leads to increased levels of active, GTP-bound RHOA (PubMed:26529257). May be required for lung development (By similarity).By similarityCurated3 Publications

Miscellaneous

Maps within a region of overlapping homozygous deletions characterized in both small cell lung cancer cell lines (SCLC) and in a breast cancer cell line. The promoter region of ROBO1 shows complete hypermethylation of CpG sites in the BT-20 breast tumor cell lines, some primary invasive breast carcinomasa and some primary clear cell renal cell carcinomas (CC-RCC).

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • axon guidance receptor activity Source: ProtInc
  • identical protein binding Source: UniProtKB
  • LRR domain binding Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, Receptor
Biological processChemotaxis, Differentiation, Neurogenesis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-373752 Netrin-1 signaling
R-HSA-376176 Signaling by ROBO receptors
R-HSA-428540 Activation of RAC1
R-HSA-428542 Regulation of commissural axon pathfinding by SLIT and ROBO
R-HSA-428543 Inactivation of CDC42 and RAC1
R-HSA-428890 Role of ABL in ROBO-SLIT signaling
R-HSA-8985586 SLIT2:ROBO1 increases RHOA activity
R-HSA-8985801 Regulation of cortical dendrite branching
R-HSA-9010553 Regulation of expression of SLITs and ROBOs

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9Y6N7

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Roundabout homolog 1
Alternative name(s):
Deleted in U twenty twenty
H-Robo-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ROBO1
Synonyms:DUTT1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000169855.19

Human Gene Nomenclature Database

More...
HGNCi
HGNC:10249 ROBO1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602430 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y6N7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini26 – 897ExtracellularSequence analysisAdd BLAST872
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei898 – 918HelicalSequence analysisAdd BLAST21
Topological domaini919 – 1651CytoplasmicSequence analysisAdd BLAST733

Keywords - Cellular componenti

Cell membrane, Cell projection, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
6091

MalaCards human disease database

More...
MalaCardsi
ROBO1

Open Targets

More...
OpenTargetsi
ENSG00000169855

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
95496 Pituitary stalk interruption syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA34620

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ROBO1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
49036500

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 25Sequence analysisAdd BLAST25
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000003103326 – 1651Roundabout homolog 1Add BLAST1626

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi89 ↔ 147PROSITE-ProRule annotationCombined sources1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi160N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi191 ↔ 240PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi283 ↔ 330PROSITE-ProRule annotation
Disulfide bondi372 ↔ 428PROSITE-ProRule annotation
Glycosylationi463N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi476 ↔ 525PROSITE-ProRule annotationCombined sources1 Publication
Glycosylationi790N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi820N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi827N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei940PhosphoserineCombined sources1
Modified residuei948PhosphothreonineCombined sources1
Modified residuei1038Phosphotyrosine; by ABL; in vitro1 Publication1
Modified residuei1055PhosphoserineCombined sources1
Modified residuei1073Phosphotyrosine; by ABL; in vitro1 Publication1
Modified residuei1114Phosphotyrosine; by ABL; in vitro1 Publication1
Modified residuei1240PhosphothreonineCombined sources1
Modified residuei1297PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Ubiquitinated. May be deubiquitinated by USP33.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9Y6N7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y6N7

PeptideAtlas

More...
PeptideAtlasi
Q9Y6N7

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y6N7

ProteomicsDB human proteome resource

More...
ProteomicsDBi
86744
86745 [Q9Y6N7-2]
86746 [Q9Y6N7-3]
86747 [Q9Y6N7-4]
86748 [Q9Y6N7-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y6N7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y6N7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed, with exception of kidney.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000169855 Expressed in 223 organ(s), highest expression level in forebrain

CleanEx database of gene expression profiles

More...
CleanExi
HS_ROBO1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9Y6N7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Y6N7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB013524
HPA052968
HPA074461

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Dimerization is mediated by the extracellular domain and is independent of SLIT liganding (PubMed:24673457). Interacts with SLIT1 (By similarity). Interacts with SLIT2 (PubMed:10102268, PubMed:11404413, PubMed:17848514). Interacts with FLRT3 (PubMed:24560577). Interacts with MYO9B (via Rho-GAP domain) (PubMed:26529257).By similarity6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112018, 16 interactors

Database of interacting proteins

More...
DIPi
DIP-33034N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q9Y6N7

Protein interaction database and analysis system

More...
IntActi
Q9Y6N7, 12 interactors

Molecular INTeraction database

More...
MINTi
Q9Y6N7

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000420321

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11651
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9Y6N7

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Y6N7

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9Y6N7

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini68 – 164Ig-like C2-type 1Add BLAST97
Domaini170 – 257Ig-like C2-type 2Add BLAST88
Domaini262 – 346Ig-like C2-type 3Add BLAST85
Domaini351 – 446Ig-like C2-type 4Add BLAST96
Domaini455 – 541Ig-like C2-type 5Add BLAST87
Domaini563 – 657Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST95
Domaini676 – 773Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST98
Domaini778 – 874Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST97

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the immunoglobulin superfamily. ROBO family.Curated

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4222 Eukaryota
ENOG410XPQS LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154477

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000010267

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG073476

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y6N7

KEGG Orthology (KO)

More...
KOi
K06753

Identification of Orthologs from Complete Genome Data

More...
OMAi
REAYTDD

Database of Orthologous Groups

More...
OrthoDBi
EOG091G00CG

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y6N7

TreeFam database of animal gene trees

More...
TreeFami
TF351053

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00063 FN3, 3 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 8 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR013106 Ig_V-set
IPR032986 Robo1

The PANTHER Classification System

More...
PANTHERi
PTHR44096:SF1 PTHR44096:SF1, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00041 fn3, 3 hits
PF07679 I-set, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00060 FN3, 3 hits
SM00409 IG, 5 hits
SM00408 IGc2, 5 hits
SM00406 IGv, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 5 hits
SSF49265 SSF49265, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50853 FN3, 3 hits
PS50835 IG_LIKE, 5 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y6N7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKWKHVPFLV MISLLSLSPN HLFLAQLIPD PEDVERGNDH GTPIPTSDND
60 70 80 90 100
DNSLGYTGSR LRQEDFPPRI VEHPSDLIVS KGEPATLNCK AEGRPTPTIE
110 120 130 140 150
WYKGGERVET DKDDPRSHRM LLPSGSLFFL RIVHGRKSRP DEGVYVCVAR
160 170 180 190 200
NYLGEAVSHN ASLEVAILRD DFRQNPSDVM VAVGEPAVME CQPPRGHPEP
210 220 230 240 250
TISWKKDGSP LDDKDERITI RGGKLMITYT RKSDAGKYVC VGTNMVGERE
260 270 280 290 300
SEVAELTVLE RPSFVKRPSN LAVTVDDSAE FKCEARGDPV PTVRWRKDDG
310 320 330 340 350
ELPKSRYEIR DDHTLKIRKV TAGDMGSYTC VAENMVGKAE ASATLTVQEP
360 370 380 390 400
PHFVVKPRDQ VVALGRTVTF QCEATGNPQP AIFWRREGSQ NLLFSYQPPQ
410 420 430 440 450
SSSRFSVSQT GDLTITNVQR SDVGYYICQT LNVAGSIITK AYLEVTDVIA
460 470 480 490 500
DRPPPVIRQG PVNQTVAVDG TFVLSCVATG SPVPTILWRK DGVLVSTQDS
510 520 530 540 550
RIKQLENGVL QIRYAKLGDT GRYTCIASTP SGEATWSAYI EVQEFGVPVQ
560 570 580 590 600
PPRPTDPNLI PSAPSKPEVT DVSRNTVTLS WQPNLNSGAT PTSYIIEAFS
610 620 630 640 650
HASGSSWQTV AENVKTETSA IKGLKPNAIY LFLVRAANAY GISDPSQISD
660 670 680 690 700
PVKTQDVLPT SQGVDHKQVQ RELGNAVLHL HNPTVLSSSS IEVHWTVDQQ
710 720 730 740 750
SQYIQGYKIL YRPSGANHGE SDWLVFEVRT PAKNSVVIPD LRKGVNYEIK
760 770 780 790 800
ARPFFNEFQG ADSEIKFAKT LEEAPSAPPQ GVTVSKNDGN GTAILVSWQP
810 820 830 840 850
PPEDTQNGMV QEYKVWCLGN ETRYHINKTV DGSTFSVVIP FLVPGIRYSV
860 870 880 890 900
EVAASTGAGS GVKSEPQFIQ LDAHGNPVSP EDQVSLAQQI SDVVKQPAFI
910 920 930 940 950
AGIGAACWII LMVFSIWLYR HRKKRNGLTS TYAGIRKVPS FTFTPTVTYQ
960 970 980 990 1000
RGGEAVSSGG RPGLLNISEP AAQPWLADTW PNTGNNHNDC SISCCTAGNG
1010 1020 1030 1040 1050
NSDSNLTTYS RPADCIANYN NQLDNKQTNL MLPESTVYGD VDLSNKINEM
1060 1070 1080 1090 1100
KTFNSPNLKD GRFVNPSGQP TPYATTQLIQ SNLSNNMNNG SGDSGEKHWK
1110 1120 1130 1140 1150
PLGQQKQEVA PVQYNIVEQN KLNKDYRAND TVPPTIPYNQ SYDQNTGGSY
1160 1170 1180 1190 1200
NSSDRGSSTS GSQGHKKGAR TPKVPKQGGM NWADLLPPPP AHPPPHSNSE
1210 1220 1230 1240 1250
EYNISVDESY DQEMPCPVPP ARMYLQQDEL EEEEDERGPT PPVRGAASSP
1260 1270 1280 1290 1300
AAVSYSHQST ATLTPSPQEE LQPMLQDCPE ETGHMQHQPD RRRQPVSPPP
1310 1320 1330 1340 1350
PPRPISPPHT YGYISGPLVS DMDTDAPEEE EDEADMEVAK MQTRRLLLRG
1360 1370 1380 1390 1400
LEQTPASSVG DLESSVTGSM INGWGSASEE DNISSGRSSV SSSDGSFFTD
1410 1420 1430 1440 1450
ADFAQAVAAA AEYAGLKVAR RQMQDAAGRR HFHASQCPRP TSPVSTDSNM
1460 1470 1480 1490 1500
SAAVMQKTRP AKKLKHQPGH LRRETYTDDL PPPPVPPPAI KSPTAQSKTQ
1510 1520 1530 1540 1550
LEVRPVVVPK LPSMDARTDR SSDRKGSSYK GREVLDGRQV VDMRTNPGDP
1560 1570 1580 1590 1600
REAQEQQNDG KGRGNKAAKR DLPPAKTHLI QEDILPYCRP TFPTSNNPRD
1610 1620 1630 1640 1650
PSSSSSMSSR GSGSRQREQA NVGRRNIAEM QVLGGYERGE DNNEELEETE

S
Length:1,651
Mass (Da):180,930
Last modified:November 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9D98CD7CAB73074D
GO
Isoform 2 (identifier: Q9Y6N7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     543-543: Q → QGKVN

Note: Incomplete.
Show »
Length:1,655
Mass (Da):181,328
Checksum:iEB2C3DFF6013A30F
GO
Isoform 3 (identifier: Q9Y6N7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: Missing.
     40-57: HGTPIPTSDNDDNSLGYT → MIAEPAHFYLFGLICLCS
     348-348: Q → QVGS

Show »
Length:1,615
Mass (Da):176,814
Checksum:i66D6413527161E25
GO
Isoform 4 (identifier: Q9Y6N7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: Missing.
     40-57: HGTPIPTSDNDDNSLGYT → MIAEPAHFYLFGLICLCS

Show »
Length:1,612
Mass (Da):176,571
Checksum:i4625E96485E88C34
GO
Isoform 5 (identifier: Q9Y6N7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MKWKHVPFLVMISLLSLSPNHLFLAQLIPDPEDVERGNDHGTPIPTSDNDDNSLGYT → MIAEPAHFYLFGLICLCS
     348-348: Q → QVGS
     938-946: Missing.

Note: No experimental confirmation available.
Show »
Length:1,606
Mass (Da):175,836
Checksum:i79FA0AA96275B1A2
GO
Isoform 6 (identifier: Q9Y6N7-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MKWKHVPFLVMISLLSLSPNHLFLAQLIPDPEDVERGNDHGTPIPTSDNDDNSLGYT → MIAEPAHFYLFGLICLCS
     348-348: Q → QVGS
     938-946: Missing.
     1013-1067: Missing.

Note: No experimental confirmation available.
Show »
Length:1,551
Mass (Da):169,661
Checksum:i89F1C62C15B8C9A2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WTM1A0A087WTM1_HUMAN
Roundabout homolog 1
ROBO1
1,606Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WZ85A0A087WZ85_HUMAN
Roundabout homolog 1
ROBO1
1,525Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSX4A0A0A0MSX4_HUMAN
Roundabout homolog 1
ROBO1
1,531Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C545H7C545_HUMAN
Roundabout homolog 1
ROBO1
190Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4Y7H7C4Y7_HUMAN
Roundabout homolog 1
ROBO1
192Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WEV8F8WEV8_HUMAN
Roundabout homolog 1
ROBO1
41Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti182A → V in AAI15023 (PubMed:15489334).Curated1
Sequence conflicti835F → L in AAI15023 (PubMed:15489334).Curated1
Sequence conflicti1095G → S in CAD98093 (PubMed:17974005).Curated1
Sequence conflicti1223M → T in Z95705 (PubMed:16641997).Curated1
Sequence conflicti1443P → L in CAD98093 (PubMed:17974005).Curated1
Sequence conflicti1536D → G in Z95705 (PubMed:16641997).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_053640336V → A. Corresponds to variant dbSNP:rs9647397Ensembl.1
Natural variantiVAR_0190711055S → N in a breast cancer sample. 1 PublicationCorresponds to variant dbSNP:rs919603543Ensembl.1
Natural variantiVAR_0536411091S → N. Corresponds to variant dbSNP:rs35456279Ensembl.1
Natural variantiVAR_0190721533E → D in a breast cancer sample. 1 PublicationCorresponds to variant dbSNP:rs36055689Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0438811 – 57MKWKH…SLGYT → MIAEPAHFYLFGLICLCS in isoform 5 and isoform 6. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_0106431 – 39Missing in isoform 3 and isoform 4. CuratedAdd BLAST39
Alternative sequenceiVSP_01064440 – 57HGTPI…SLGYT → MIAEPAHFYLFGLICLCS in isoform 3 and isoform 4. CuratedAdd BLAST18
Alternative sequenceiVSP_010645348Q → QVGS in isoform 3, isoform 5 and isoform 6. 1 Publication1
Alternative sequenceiVSP_010646543Q → QGKVN in isoform 2. 1 Publication1
Alternative sequenceiVSP_043882938 – 946Missing in isoform 5 and isoform 6. 1 Publication9
Alternative sequenceiVSP_0460841013 – 1067Missing in isoform 6. 1 PublicationAdd BLAST55

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF040990 mRNA Translation: AAC39575.1
Z95705 Genomic DNA No translation available.
AC016946 Genomic DNA No translation available.
AC055731 Genomic DNA No translation available.
AC106718 Genomic DNA No translation available.
AC106720 Genomic DNA No translation available.
AC108719 Genomic DNA No translation available.
AC117461 Genomic DNA No translation available.
AC117479 Genomic DNA No translation available.
AC119035 Genomic DNA No translation available.
AC123565 Genomic DNA No translation available.
AC125624 Genomic DNA No translation available.
AC125766 Genomic DNA No translation available.
AC125815 Genomic DNA No translation available.
AC131008 Genomic DNA No translation available.
CH471110 Genomic DNA Translation: EAW68884.1
CH471110 Genomic DNA Translation: EAW68885.1
BC001969 mRNA Translation: AAH01969.1
BC115022 mRNA Translation: AAI15023.1
BC157861 mRNA Translation: AAI57862.1
BC171855 mRNA Translation: AAI71855.1
BX538319 mRNA Translation: CAD98093.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS46872.2 [Q9Y6N7-5]
CCDS54610.1 [Q9Y6N7-6]
CCDS54611.1 [Q9Y6N7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001139317.1, NM_001145845.1 [Q9Y6N7-6]
NP_002932.1, NM_002941.3 [Q9Y6N7-1]
NP_598334.2, NM_133631.3 [Q9Y6N7-5]
XP_006713340.1, XM_006713277.2 [Q9Y6N7-3]
XP_016862472.1, XM_017006983.1 [Q9Y6N7-4]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.744218

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000464233; ENSP00000420321; ENSG00000169855 [Q9Y6N7-1]
ENST00000467549; ENSP00000417992; ENSG00000169855 [Q9Y6N7-6]
ENST00000495273; ENSP00000420637; ENSG00000169855 [Q9Y6N7-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6091

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6091

UCSC genome browser

More...
UCSCi
uc003dqc.3 human [Q9Y6N7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF040990 mRNA Translation: AAC39575.1
Z95705 Genomic DNA No translation available.
AC016946 Genomic DNA No translation available.
AC055731 Genomic DNA No translation available.
AC106718 Genomic DNA No translation available.
AC106720 Genomic DNA No translation available.
AC108719 Genomic DNA No translation available.
AC117461 Genomic DNA No translation available.
AC117479 Genomic DNA No translation available.
AC119035 Genomic DNA No translation available.
AC123565 Genomic DNA No translation available.
AC125624 Genomic DNA No translation available.
AC125766 Genomic DNA No translation available.
AC125815 Genomic DNA No translation available.
AC131008 Genomic DNA No translation available.
CH471110 Genomic DNA Translation: EAW68884.1
CH471110 Genomic DNA Translation: EAW68885.1
BC001969 mRNA Translation: AAH01969.1
BC115022 mRNA Translation: AAI15023.1
BC157861 mRNA Translation: AAI57862.1
BC171855 mRNA Translation: AAI71855.1
BX538319 mRNA Translation: CAD98093.1
CCDSiCCDS46872.2 [Q9Y6N7-5]
CCDS54610.1 [Q9Y6N7-6]
CCDS54611.1 [Q9Y6N7-1]
RefSeqiNP_001139317.1, NM_001145845.1 [Q9Y6N7-6]
NP_002932.1, NM_002941.3 [Q9Y6N7-1]
NP_598334.2, NM_133631.3 [Q9Y6N7-5]
XP_006713340.1, XM_006713277.2 [Q9Y6N7-3]
XP_016862472.1, XM_017006983.1 [Q9Y6N7-4]
UniGeneiHs.744218

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EO9NMR-A454-564[»]
2V9QX-ray2.50A61-266[»]
2V9RX-ray2.00A61-266[»]
2V9TX-ray1.70A61-166[»]
3WIHX-ray1.70A/B777-873[»]
4HLJX-ray1.80A660-897[»]
5O5GX-ray3.03A63-446[»]
5O5IX-ray3.01A454-543[»]
5OPEX-ray2.54A63-447[»]
ProteinModelPortaliQ9Y6N7
SMRiQ9Y6N7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112018, 16 interactors
DIPiDIP-33034N
ELMiQ9Y6N7
IntActiQ9Y6N7, 12 interactors
MINTiQ9Y6N7
STRINGi9606.ENSP00000420321

PTM databases

iPTMnetiQ9Y6N7
PhosphoSitePlusiQ9Y6N7

Polymorphism and mutation databases

BioMutaiROBO1
DMDMi49036500

Proteomic databases

EPDiQ9Y6N7
PaxDbiQ9Y6N7
PeptideAtlasiQ9Y6N7
PRIDEiQ9Y6N7
ProteomicsDBi86744
86745 [Q9Y6N7-2]
86746 [Q9Y6N7-3]
86747 [Q9Y6N7-4]
86748 [Q9Y6N7-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000464233; ENSP00000420321; ENSG00000169855 [Q9Y6N7-1]
ENST00000467549; ENSP00000417992; ENSG00000169855 [Q9Y6N7-6]
ENST00000495273; ENSP00000420637; ENSG00000169855 [Q9Y6N7-5]
GeneIDi6091
KEGGihsa:6091
UCSCiuc003dqc.3 human [Q9Y6N7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6091
DisGeNETi6091
EuPathDBiHostDB:ENSG00000169855.19

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ROBO1
HGNCiHGNC:10249 ROBO1
HPAiCAB013524
HPA052968
HPA074461
MalaCardsiROBO1
MIMi602430 gene
neXtProtiNX_Q9Y6N7
OpenTargetsiENSG00000169855
Orphaneti95496 Pituitary stalk interruption syndrome
PharmGKBiPA34620

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4222 Eukaryota
ENOG410XPQS LUCA
GeneTreeiENSGT00940000154477
HOGENOMiHOG000010267
HOVERGENiHBG073476
InParanoidiQ9Y6N7
KOiK06753
OMAiREAYTDD
OrthoDBiEOG091G00CG
PhylomeDBiQ9Y6N7
TreeFamiTF351053

Enzyme and pathway databases

ReactomeiR-HSA-373752 Netrin-1 signaling
R-HSA-376176 Signaling by ROBO receptors
R-HSA-428540 Activation of RAC1
R-HSA-428542 Regulation of commissural axon pathfinding by SLIT and ROBO
R-HSA-428543 Inactivation of CDC42 and RAC1
R-HSA-428890 Role of ABL in ROBO-SLIT signaling
R-HSA-8985586 SLIT2:ROBO1 increases RHOA activity
R-HSA-8985801 Regulation of cortical dendrite branching
R-HSA-9010553 Regulation of expression of SLITs and ROBOs
SIGNORiQ9Y6N7

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ROBO1 human
EvolutionaryTraceiQ9Y6N7

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ROBO1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6091

Protein Ontology

More...
PROi
PR:Q9Y6N7

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000169855 Expressed in 223 organ(s), highest expression level in forebrain
CleanExiHS_ROBO1
ExpressionAtlasiQ9Y6N7 baseline and differential
GenevisibleiQ9Y6N7 HS

Family and domain databases

CDDicd00063 FN3, 3 hits
Gene3Di2.60.40.10, 8 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR013106 Ig_V-set
IPR032986 Robo1
PANTHERiPTHR44096:SF1 PTHR44096:SF1, 1 hit
PfamiView protein in Pfam
PF00041 fn3, 3 hits
PF07679 I-set, 2 hits
SMARTiView protein in SMART
SM00060 FN3, 3 hits
SM00409 IG, 5 hits
SM00408 IGc2, 5 hits
SM00406 IGv, 2 hits
SUPFAMiSSF48726 SSF48726, 5 hits
SSF49265 SSF49265, 2 hits
PROSITEiView protein in PROSITE
PS50853 FN3, 3 hits
PS50835 IG_LIKE, 5 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiROBO1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y6N7
Secondary accession number(s): B2RXI1
, D3DU36, E9PD49, Q1RMC7, Q7Z300, Q9BUS7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 21, 2004
Last sequence update: November 1, 1999
Last modified: December 5, 2018
This is version 173 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again