Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 171 (02 Jun 2021)
Sequence version 3 (01 Mar 2005)
Previous versions | rss
Add a publicationFeedback
Protein

Cytochrome c oxidase assembly protein COX11, mitochondrial

Gene

COX11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Exerts its effect at some terminal stage of cytochrome c oxidase synthesis, probably by being involved in the insertion of the copper B into subunit I.

By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • copper ion binding Source: InterPro
  • electron transfer activity Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandCopper

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9Y6N1

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5628897, TP53 Regulates Metabolic Genes
R-HSA-611105, Respiratory electron transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cytochrome c oxidase assembly protein COX11, mitochondrial
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:COX11
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2261, COX11

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603648, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y6N1

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000166260.10

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini? – 95Mitochondrial matrix1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei96 – 114HelicalSequence analysisAdd BLAST19
Topological domaini115 – 276Mitochondrial intermembrane1 PublicationAdd BLAST162

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
1353

Open Targets

More...
OpenTargetsi
ENSG00000166260

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26777

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9Y6N1, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
COX11

Domain mapping of disease mutations (DMDM)

More...
DMDMi
60416378

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – ?MitochondrionSequence analysis
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000006080? – 276Cytochrome c oxidase assembly protein COX11, mitochondrial

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9Y6N1

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9Y6N1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9Y6N1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y6N1

PeptideAtlas

More...
PeptideAtlasi
Q9Y6N1

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y6N1

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
46815
86740 [Q9Y6N1-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y6N1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y6N1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000166260, Expressed in heart right ventricle and 249 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9Y6N1, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Y6N1, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000166260, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CNNM4/ACDP4.

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
107746, 21 interactors

Protein interaction database and analysis system

More...
IntActi
Q9Y6N1, 16 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000299335

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9Y6N1, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni64 – 92DisorderedSequence analysisAdd BLAST29

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the COX11/CtaG family.Curated

Keywords - Domaini

Transit peptide, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2540, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000007512

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_045000_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y6N1

Identification of Orthologs from Complete Genome Data

More...
OMAi
NKLECFC

Database of Orthologous Groups

More...
OrthoDBi
1287401at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y6N1

TreeFam database of animal gene trees

More...
TreeFami
TF105072

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.370.10, 1 hit

HAMAP database of protein families

More...
HAMAPi
MF_00155, CtaG, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR023471, CtaG/Cox11_dom_sf
IPR007533, Cyt_c_oxidase_assmbl_CtaG

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04442, CtaG_Cox11, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF110111, SSF110111, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y6N1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGGLWRPGWR CVPFCGWRWI HPGSPTRAAE RVEPFLRPEW SGTGGAERGL
60 70 80 90 100
RWLGTWKRCS LRARHPALQP PRRPKSSNPF TRAQEEERRR QNKTTLTYVA
110 120 130 140 150
AVAVGMLGAS YAAVPLYRLY CQTTGLGGSA VAGHASDKIE NMVPVKDRII
160 170 180 190 200
KISFNADVHA SLQWNFRPQQ TEIYVVPGET ALAFYRAKNP TDKPVIGIST
210 220 230 240 250
YNIVPFEAGQ YFNKIQCFCF EEQRLNPQEE VDMPVFFYID PEFAEDPRMI
260 270
KVDLITLSYT FFEAKEGHKL PVPGYN
Length:276
Mass (Da):31,430
Last modified:March 1, 2005 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1F2BD22E1E7DD52D
GO
Isoform 2 (identifier: Q9Y6N1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     217-276: CFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN → ASKLHRVYVLESWHL

Show »
Length:231
Mass (Da):26,133
Checksum:i3A8BC28441A3D78B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4DI26B4DI26_HUMAN
Cytochrome c oxidase assembly prote...
COX11
230Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L4E7I3L4E7_HUMAN
Cytochrome c oxidase assembly prote...
COX11
51Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti187A → V in AAH05895 (PubMed:15489334).Curated1
Isoform 2 (identifier: Q9Y6N1-2)
Sequence conflicti223V → G in BI600359 (Ref. 4) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04883174P → L. Corresponds to variant dbSNP:rs34080917Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_046360217 – 276CFCFE…VPGYN → ASKLHRVYVLESWHL in isoform 2. 1 PublicationAdd BLAST60

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF044321 mRNA Translation: AAD08645.1
CR541837 mRNA Translation: CAG46636.1
AC007485 Genomic DNA No translation available.
AC090824 Genomic DNA No translation available.
CH471109 Genomic DNA Translation: EAW94548.1
CH471109 Genomic DNA Translation: EAW94550.1
BC005895 mRNA Translation: AAH05895.1
BI600359 mRNA No translation available.
U79270 mRNA Translation: AAB50214.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11583.1 [Q9Y6N1-1]
CCDS58579.1 [Q9Y6N1-2]

NCBI Reference Sequences

More...
RefSeqi
NP_004366.1, NM_004375.4 [Q9Y6N1-1]
XP_011522644.1, XM_011524342.2 [Q9Y6N1-1]
XP_016879681.1, XM_017024192.1 [Q9Y6N1-1]
XP_016879682.1, XM_017024193.1 [Q9Y6N1-1]
XP_016879683.1, XM_017024194.1
XP_016879684.1, XM_017024195.1
XP_016879685.1, XM_017024196.1 [Q9Y6N1-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000299335; ENSP00000299335; ENSG00000166260 [Q9Y6N1-1]
ENST00000572558; ENSP00000459302; ENSG00000166260 [Q9Y6N1-2]
ENST00000576370; ENSP00000459901; ENSG00000166260 [Q9Y6N1-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1353

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1353

UCSC genome browser

More...
UCSCi
uc010wng.2, human [Q9Y6N1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF044321 mRNA Translation: AAD08645.1
CR541837 mRNA Translation: CAG46636.1
AC007485 Genomic DNA No translation available.
AC090824 Genomic DNA No translation available.
CH471109 Genomic DNA Translation: EAW94548.1
CH471109 Genomic DNA Translation: EAW94550.1
BC005895 mRNA Translation: AAH05895.1
BI600359 mRNA No translation available.
U79270 mRNA Translation: AAB50214.1
CCDSiCCDS11583.1 [Q9Y6N1-1]
CCDS58579.1 [Q9Y6N1-2]
RefSeqiNP_004366.1, NM_004375.4 [Q9Y6N1-1]
XP_011522644.1, XM_011524342.2 [Q9Y6N1-1]
XP_016879681.1, XM_017024192.1 [Q9Y6N1-1]
XP_016879682.1, XM_017024193.1 [Q9Y6N1-1]
XP_016879683.1, XM_017024194.1
XP_016879684.1, XM_017024195.1
XP_016879685.1, XM_017024196.1 [Q9Y6N1-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi107746, 21 interactors
IntActiQ9Y6N1, 16 interactors
STRINGi9606.ENSP00000299335

PTM databases

iPTMnetiQ9Y6N1
PhosphoSitePlusiQ9Y6N1

Genetic variation databases

BioMutaiCOX11
DMDMi60416378

Proteomic databases

EPDiQ9Y6N1
jPOSTiQ9Y6N1
MassIVEiQ9Y6N1
PaxDbiQ9Y6N1
PeptideAtlasiQ9Y6N1
PRIDEiQ9Y6N1
ProteomicsDBi46815
86740 [Q9Y6N1-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
30833, 135 antibodies

The DNASU plasmid repository

More...
DNASUi
1353

Genome annotation databases

EnsembliENST00000299335; ENSP00000299335; ENSG00000166260 [Q9Y6N1-1]
ENST00000572558; ENSP00000459302; ENSG00000166260 [Q9Y6N1-2]
ENST00000576370; ENSP00000459901; ENSG00000166260 [Q9Y6N1-1]
GeneIDi1353
KEGGihsa:1353
UCSCiuc010wng.2, human [Q9Y6N1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1353
DisGeNETi1353

GeneCards: human genes, protein and diseases

More...
GeneCardsi
COX11
HGNCiHGNC:2261, COX11
HPAiENSG00000166260, Low tissue specificity
MIMi603648, gene
neXtProtiNX_Q9Y6N1
OpenTargetsiENSG00000166260
PharmGKBiPA26777
VEuPathDBiHostDB:ENSG00000166260.10

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2540, Eukaryota
GeneTreeiENSGT00390000007512
HOGENOMiCLU_045000_1_0_1
InParanoidiQ9Y6N1
OMAiNKLECFC
OrthoDBi1287401at2759
PhylomeDBiQ9Y6N1
TreeFamiTF105072

Enzyme and pathway databases

PathwayCommonsiQ9Y6N1
ReactomeiR-HSA-5628897, TP53 Regulates Metabolic Genes
R-HSA-611105, Respiratory electron transport

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
1353, 221 hits in 997 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
COX11, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1353
PharosiQ9Y6N1, Tbio

Protein Ontology

More...
PROi
PR:Q9Y6N1
RNActiQ9Y6N1, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000166260, Expressed in heart right ventricle and 249 other tissues
ExpressionAtlasiQ9Y6N1, baseline and differential
GenevisibleiQ9Y6N1, HS

Family and domain databases

Gene3Di2.60.370.10, 1 hit
HAMAPiMF_00155, CtaG, 1 hit
InterProiView protein in InterPro
IPR023471, CtaG/Cox11_dom_sf
IPR007533, Cyt_c_oxidase_assmbl_CtaG
PfamiView protein in Pfam
PF04442, CtaG_Cox11, 1 hit
SUPFAMiSSF110111, SSF110111, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCOX11_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y6N1
Secondary accession number(s): D3DTY5
, I3L220, Q6FHB7, Q9BRX0, Q9UME8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: March 1, 2005
Last modified: June 2, 2021
This is version 171 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again