Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 158 (08 May 2019)
Sequence version 2 (05 May 2009)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Sodium bicarbonate cotransporter 3

Gene

SLC4A7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Electroneutral sodium- and bicarbonate-dependent cotransporter with a Na+:HCO3- 1:1 stoichiometry. Regulates intracellular pH and may play a role in bicarbonate salvage in secretory epithelia. May also have an associated sodium channel activity.2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Transporter activity is regulated by CA2/carbonic anhydrase 2, cAMP and PKA. Insensitive to stilbene derivatives. PubMed:10347222 states it is inhibited by 5-(N-ethyl-N-isopropyl)-amiloride (EIPA).

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=24 mM for external sodium1 Publication

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Biological processIon transport, Sodium transport, Symport, Transport
    LigandSodium

    Enzyme and pathway databases

    Reactome - a knowledgebase of biological pathways and processes

    More...
    Reactomei
    R-HSA-425381 Bicarbonate transporters

    Protein family/group databases

    Transport Classification Database

    More...
    TCDBi
    2.A.31.2.11 the anion exchanger (ae) family

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Sodium bicarbonate cotransporter 3
    Alternative name(s):
    Electroneutral Na/HCO(3) cotransporter
    Sodium bicarbonate cotransporter 2
    Sodium bicarbonate cotransporter 2b
    Short name:
    Bicarbonate transporter
    Solute carrier family 4 member 7
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:SLC4A7
    Synonyms:BT, NBC2, NBC2B, NBC3, NBCn1, SBC2, SLC4A6
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

    Organism-specific databases

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:11033 SLC4A7

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    603353 gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_Q9Y6M7

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Topology

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 608ExtracellularSequence analysisAdd BLAST608
    <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei609 – 629HelicalSequence analysisAdd BLAST21
    Topological domaini630 – 637CytoplasmicSequence analysis8
    Transmembranei638 – 658HelicalSequence analysisAdd BLAST21
    Topological domaini659 – 695ExtracellularSequence analysisAdd BLAST37
    Transmembranei696 – 716HelicalSequence analysisAdd BLAST21
    Topological domaini717 – 725CytoplasmicSequence analysis9
    Transmembranei726 – 746HelicalSequence analysisAdd BLAST21
    Topological domaini747 – 817ExtracellularSequence analysisAdd BLAST71
    Transmembranei818 – 838HelicalSequence analysisAdd BLAST21
    Topological domaini839 – 861CytoplasmicSequence analysisAdd BLAST23
    Transmembranei862 – 882HelicalSequence analysisAdd BLAST21
    Topological domaini883 – 908ExtracellularSequence analysisAdd BLAST26
    Transmembranei909 – 929HelicalSequence analysisAdd BLAST21
    Topological domaini930 – 954CytoplasmicSequence analysisAdd BLAST25
    Transmembranei955 – 975HelicalSequence analysisAdd BLAST21
    Topological domaini976 – 1011ExtracellularSequence analysisAdd BLAST36
    Transmembranei1012 – 1032HelicalSequence analysisAdd BLAST21
    Topological domaini1033 – 1034CytoplasmicSequence analysis2
    Transmembranei1035 – 1055HelicalSequence analysisAdd BLAST21
    Topological domaini1056 – 1092ExtracellularSequence analysisAdd BLAST37
    Transmembranei1093 – 1113HelicalSequence analysisAdd BLAST21
    Topological domaini1114 – 1214CytoplasmicSequence analysisAdd BLAST101

    Keywords - Cellular componenti

    Cell membrane, Cell projection, Membrane

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1135 – 1136DD → NN: Loss of interaction with CA2. Loss of regulation by CA2. 1 Publication2
    Mutagenesisi1163 – 1165DDD → NNN: No effect on interaction with CA2. No effect on regulation by CA2. 1 Publication3
    Mutagenesisi1214L → G: Loss of interaction with ATP6V1B1. 1 Publication1

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    9497

    Open Targets

    More...
    OpenTargetsi
    ENSG00000033867

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA35899

    Chemistry databases

    ChEMBL database of bioactive drug-like small molecules

    More...
    ChEMBLi
    CHEMBL3774290

    Drug and drug target database

    More...
    DrugBanki
    DB01390 Sodium bicarbonate

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    SLC4A7

    Domain mapping of disease mutations (DMDM)

    More...
    DMDMi
    229462789

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000792331 – 1214Sodium bicarbonate cotransporter 3Add BLAST1214

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei52PhosphoserineBy similarity1
    Modified residuei55PhosphoserineCombined sources1
    Modified residuei84PhosphoserineBy similarity1
    Modified residuei150PhosphoserineBy similarity1
    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi171N-linked (GlcNAc...) asparagineSequence analysis1
    Modified residuei233PhosphoserineBy similarity1
    Modified residuei242PhosphoserineCombined sources1
    Glycosylationi269N-linked (GlcNAc...) asparagineSequence analysis1
    Modified residuei382PhosphoserineBy similarity1
    Glycosylationi398N-linked (GlcNAc...) asparagineSequence analysis1
    Modified residuei400PhosphoserineBy similarity1
    Modified residuei403PhosphoserineCombined sources1
    Glycosylationi406N-linked (GlcNAc...) asparagineSequence analysis1
    Modified residuei407PhosphoserineCombined sources1
    Modified residuei556PhosphoserineCombined sources1
    Modified residuei557PhosphothreonineCombined sources1
    <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi766 ↔ 768By similarity
    Glycosylationi776N-linked (GlcNAc...) asparagine1 Publication1
    Glycosylationi786N-linked (GlcNAc...) asparagine1 Publication1
    Glycosylationi791N-linked (GlcNAc...) asparagine1 Publication1
    Disulfide bondi802 ↔ 814By similarity
    Modified residuei1167PhosphothreonineCombined sources1
    Modified residuei1176PhosphoserineCombined sources1
    Modified residuei1213PhosphoserineCombined sources1
    Isoform 3 (identifier: Q9Y6M7-3)
    Modified residuei165PhosphoserineCombined sources1
    Modified residuei168PhosphoserineCombined sources1
    Modified residuei1007PhosphoserineCombined sources1
    Modified residuei1010PhosphoserineCombined sources1
    Modified residuei1016PhosphoserineCombined sources1
    Isoform 4 (identifier: Q9Y6M7-4)
    Modified residuei165PhosphoserineCombined sources1
    Modified residuei168PhosphoserineCombined sources1
    Isoform 2 (identifier: Q9Y6M7-2)
    Modified residuei255PhosphoserineCombined sources1
    Modified residuei258PhosphoserineCombined sources1
    Isoform 6 (identifier: Q9Y6M7-6)
    Modified residuei260PhosphoserineCombined sources1
    Modified residuei263PhosphoserineCombined sources1
    Modified residuei1073PhosphoserineCombined sources1
    Modified residuei1102PhosphoserineCombined sources1
    Modified residuei1105PhosphoserineCombined sources1
    Modified residuei1111PhosphoserineCombined sources1
    Isoform 9 (identifier: Q9Y6M7-9)
    Modified residuei260PhosphoserineCombined sources1
    Modified residuei263PhosphoserineCombined sources1
    Isoform 11 (identifier: Q9Y6M7-11)
    Modified residuei260PhosphoserineCombined sources1
    Modified residuei263PhosphoserineCombined sources1
    Isoform 13 (identifier: Q9Y6M7-13)
    Modified residuei264PhosphoserineCombined sources1
    Modified residuei267PhosphoserineCombined sources1
    Modified residuei1077PhosphoserineCombined sources1
    Modified residuei1106PhosphoserineCombined sources1
    Modified residuei1109PhosphoserineCombined sources1
    Modified residuei1115PhosphoserineCombined sources1
    Isoform 14 (identifier: Q9Y6M7-14)
    Modified residuei264PhosphoserineCombined sources1
    Modified residuei267PhosphoserineCombined sources1
    Isoform 5 (identifier: Q9Y6M7-5)
    Modified residuei742PhosphoserineCombined sources1
    Modified residuei771PhosphoserineCombined sources1
    Modified residuei774PhosphoserineCombined sources1
    Modified residuei780PhosphoserineCombined sources1
    Isoform 8 (identifier: Q9Y6M7-8)
    Modified residuei1188PhosphoserineCombined sources1
    Modified residuei1217PhosphoserineCombined sources1
    Modified residuei1220PhosphoserineCombined sources1
    Modified residuei1226PhosphoserineCombined sources1
    Isoform 7 (identifier: Q9Y6M7-7)
    Modified residuei1201PhosphoserineCombined sources1
    Modified residuei1230PhosphoserineCombined sources1
    Modified residuei1233PhosphoserineCombined sources1
    Modified residuei1239PhosphoserineCombined sources1

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...
    EPDi
    Q9Y6M7

    jPOST - Japan Proteome Standard Repository/Database

    More...
    jPOSTi
    Q9Y6M7

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q9Y6M7

    PeptideAtlas

    More...
    PeptideAtlasi
    Q9Y6M7

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q9Y6M7

    ProteomicsDB human proteome resource

    More...
    ProteomicsDBi
    86734
    86735 [Q9Y6M7-2]
    86736 [Q9Y6M7-3]
    86737 [Q9Y6M7-4]
    86738 [Q9Y6M7-5]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q9Y6M7

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q9Y6M7

    SwissPalm database of S-palmitoylation events

    More...
    SwissPalmi
    Q9Y6M7

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Highly expressed in testis and spleen. Also expressed in retina, colon, small intestine, ovary, thymus, prostate, muscle, heart and kidney. Isoform 1 is expressed in skeletal muscle and heart muscle.1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000033867 Expressed in 218 organ(s), highest expression level in oocyte

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    Q9Y6M7 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q9Y6M7 HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    CAB022494
    HPA035857

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Interacts with CFTR through SLC9A3R1/EBP50.

    Interacts with USH1C.

    Forms a complex with ATP6V1B1 and SLC9A3R1/EBP50.

    Interacts in a pH dependent-manner with CA2/carbonic anhydrase 2.

    4 Publications

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    114876, 43 interactors

    Protein interaction database and analysis system

    More...
    IntActi
    Q9Y6M7, 14 interactors

    Molecular INTeraction database

    More...
    MINTi
    Q9Y6M7

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000295736

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    Q9Y6M7

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1134 – 1136CA2-binding3

    Motif

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi1211 – 1214PDZ-binding4

    <p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

    The PDZ-binding motif mediates interaction with the CFTR, SLC9A3R1/EBP50 complex and probably with USH1C.1 Publication

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG1172 Eukaryota
    ENOG410XPHD LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00940000157045

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    HOG000280684

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q9Y6M7

    KEGG Orthology (KO)

    More...
    KOi
    K13858

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    WSPIIAV

    Database of Orthologous Groups

    More...
    OrthoDBi
    265068at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q9Y6M7

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF313630

    Family and domain databases

    Gene3D Structural and Functional Annotation of Protein Families

    More...
    Gene3Di
    3.40.930.10, 2 hits

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR013769 Band3_cytoplasmic_dom
    IPR011531 HCO3_transpt_C
    IPR003020 HCO3_transpt_euk
    IPR016152 PTrfase/Anion_transptr

    The PANTHER Classification System

    More...
    PANTHERi
    PTHR11453 PTHR11453, 1 hit

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF07565 Band_3_cyto, 1 hit
    PF00955 HCO3_cotransp, 1 hit

    Protein Motif fingerprint database; a protein domain database

    More...
    PRINTSi
    PR01231 HCO3TRNSPORT

    Superfamily database of structural and functional annotation

    More...
    SUPFAMi
    SSF55804 SSF55804, 2 hits

    TIGRFAMs; a protein family database

    More...
    TIGRFAMsi
    TIGR00834 ae, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (14+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 14 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 14 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q9Y6M7-1) [UniParc]FASTAAdd to basket
    Also known as: mNBC3, NBCn1-A

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MERFRLEKKL PGPDEEAVVD LGKTSSTVNT KFEKEELESH RAVYIGVHVP
    60 70 80 90 100
    FSKESRRRHR HRGHKHHHRR RKDKESDKED GRESPSYDTP SQRVQFILGT
    110 120 130 140 150
    EDDDEEHIPH DLFTEMDELC YRDGEEYEWK ETARWLKFEE DVEDGGDRWS
    160 170 180 190 200
    KPYVATLSLH SLFELRSCIL NGTVMLDMRA STLDEIADMV LDNMIASGQL
    210 220 230 240 250
    DESIRENVRE ALLKRHHHQN EKRFTSRIPL VRSFADIGKK HSDPHLLERN
    260 270 280 290 300
    GEGLSASRHS LRTGLSASNL SLRGESPLSL LLGHLLPSSR AGTPAGSRCT
    310 320 330 340 350
    TPVPTPQNSP PSSPSISRLT SRSSQESQRQ APELLVSPAS DDIPTVVIHP
    360 370 380 390 400
    PEEDLEAALK GEEQKNEENV DLTPGILASP QSAPGNLDNS KSGEIKGNGS
    410 420 430 440 450
    GGSRENSTVD FSKVDMNFMR KIPTGAEASN VLVGEVDFLE RPIIAFVRLA
    460 470 480 490 500
    PAVLLTGLTE VPVPTRFLFL LLGPAGKAPQ YHEIGRSIAT LMTDEIFHDV
    510 520 530 540 550
    AYKAKDRNDL LSGIDEFLDQ VTVLPPGEWD PSIRIEPPKS VPSQEKRKIP
    560 570 580 590 600
    VFHNGSTPTL GETPKEAAHH AGPELQRTGR LFGGLILDIK RKAPFFLSDF
    610 620 630 640 650
    KDALSLQCLA SILFLYCACM SPVITFGGLL GEATEGRISA IESLFGASLT
    660 670 680 690 700
    GIAYSLFAGQ PLTILGSTGP VLVFEKILYK FCRDYQLSYL SLRTSIGLWT
    710 720 730 740 750
    SFLCIVLVAT DASSLVCYIT RFTEEAFAAL ICIIFIYEAL EKLFDLGETY
    760 770 780 790 800
    AFNMHNNLDK LTSYSCVCTE PPNPSNETLA QWKKDNITAH NISWRNLTVS
    810 820 830 840 850
    ECKKLRGVFL GSACGHHGPY IPDVLFWCVI LFFTTFFLSS FLKQFKTKRY
    860 870 880 890 900
    FPTKVRSTIS DFAVFLTIVI MVTIDYLVGV PSPKLHVPEK FEPTHPERGW
    910 920 930 940 950
    IISPLGDNPW WTLLIAAIPA LLCTILIFMD QQITAVIINR KEHKLKKGAG
    960 970 980 990 1000
    YHLDLLMVGV MLGVCSVMGL PWFVAATVLS ISHVNSLKVE SECSAPGEQP
    1010 1020 1030 1040 1050
    KFLGIREQRV TGLMIFILMG LSVFMTSVLK FIPMPVLYGV FLYMGVSSLK
    1060 1070 1080 1090 1100
    GIQLFDRIKL FGMPAKHQPD LIYLRYVPLW KVHIFTVIQL TCLVLLWVIK
    1110 1120 1130 1140 1150
    VSAAAVVFPM MVLALVFVRK LMDLCFTKRE LSWLDDLMPE SKKKKEDDKK
    1160 1170 1180 1190 1200
    KKEKEEAERM LQDDDDTVHL PFEGGSLLQI PVKALKYSPD KPVSVKISFE
    1210
    DEPRKKYVDA ETSL
    Length:1,214
    Mass (Da):136,044
    Last modified:May 5, 2009 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7B4ADA1E3F26813C
    GO
    Isoform 2 (identifier: Q9Y6M7-2) [UniParc]FASTAAdd to basket
    Also known as: NBCn1-F

    The sequence of this isoform differs from the canonical sequence as follows:
         251-374: Missing.

    Show »
    Length:1,090
    Mass (Da):123,081
    Checksum:i541839CC9B565896
    GO
    Isoform 3 (identifier: Q9Y6M7-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-90: Missing.
         91-118: SQRVQFILGTEDDDEEHIPHDLFTEMDE → MAVTQFIHFREEIMGNMFFIIIFSTKDK
         251-374: Missing.
         1189-1214: PDKPVSVKISFEDEPRKKYVDAETSL → GDPSIGNISDEMAKTAQWKALSMNTENAKVTRSNMSPDKPVSVK

    Show »
    Length:1,018
    Mass (Da):114,205
    Checksum:iA37799D93A1E30BC
    GO
    Isoform 4 (identifier: Q9Y6M7-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-90: Missing.
         91-118: SQRVQFILGTEDDDEEHIPHDLFTEMDE → MAVTQFIHFREEIMGNMFFIIIFSTKDK
         251-374: Missing.

    Show »
    Length:1,000
    Mass (Da):112,448
    Checksum:i50FAA40A31468223
    GO
    Isoform 5 (identifier: Q9Y6M7-5) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-450: Missing.
         451-465: PAVLLTGLTEVPVPT → MEVVEAEKIVLLTSA
         1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

    Note: No experimental confirmation available.Combined sources
    Show »
    Length:800
    Mass (Da):89,745
    Checksum:iD7FB5D3479BB0935
    GO
    Isoform 6 (identifier: Q9Y6M7-6) [UniParc]FASTAAdd to basket
    Also known as: NBCn1-G

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
         251-374: Missing.
         1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

    Show »
    Length:1,131
    Mass (Da):127,359
    Checksum:iD3DC49DE4DD7F133
    GO
    Isoform 7 (identifier: Q9Y6M7-7) [UniParc]FASTAAdd to basket
    Also known as: NBCn1-D

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR
         1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

    Show »
    Length:1,259
    Mass (Da):140,766
    Checksum:iDDE8C01EB6C6E00F
    GO
    Isoform 8 (identifier: Q9Y6M7-8) [UniParc]FASTAAdd to basket
    Also known as: NBCn1-C

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR
         238-250: Missing.
         1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

    Show »
    Length:1,246
    Mass (Da):139,254
    Checksum:iDEA67883267065E6
    GO
    Isoform 9 (identifier: Q9Y6M7-9) [UniParc]FASTAAdd to basket
    Also known as: NBCn1-E

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
         251-374: Missing.

    Show »
    Length:1,095
    Mass (Da):123,409
    Checksum:iA3CD8C2972A7DFB3
    GO
    Isoform 10 (identifier: Q9Y6M7-10) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
         238-250: Missing.
         581-582: LF → VQ
         583-1214: Missing.

    Show »
    Length:574
    Mass (Da):63,699
    Checksum:i57ECD93FDB48A158
    GO
    Isoform 11 (identifier: Q9Y6M7-11) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
         251-374: Missing.
         581-582: LF → VQ
         583-1214: Missing.

    Show »
    Length:463
    Mass (Da):52,249
    Checksum:iBFD9ACB2B9362149
    GO
    Isoform 12 (identifier: Q9Y6M7-12) [UniParc]FASTAAdd to basket
    Also known as: NBCn1-H

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
         238-250: Missing.

    Show »
    Length:1,206
    Mass (Da):134,860
    Checksum:i8A29DF5AD5ECE7E6
    GO
    Isoform 13 (identifier: Q9Y6M7-13) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR
         251-374: Missing.
         1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

    Show »
    Length:1,135
    Mass (Da):127,803
    Checksum:i77E065DA75256869
    GO
    Isoform 14 (identifier: Q9Y6M7-14) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR
         251-374: Missing.
         581-582: LF → VQ
         583-1214: Missing.

    Show »
    Length:467
    Mass (Da):52,692
    Checksum:i80F478ACDCBA905A
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    E9PFN4E9PFN4_HUMAN
    Anion exchange protein
    SLC4A7
    1,210Annotation score:

    Annotation score:2 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    C9JRP1C9JRP1_HUMAN
    Anion exchange protein
    SLC4A7
    1,051Annotation score:

    Annotation score:2 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H7C3C4H7C3C4_HUMAN
    Anion exchange protein
    SLC4A7
    801Annotation score:

    Annotation score:2 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    A0A0A0MST8A0A0A0MST8_HUMAN
    Anion exchange protein
    SLC4A7
    1,201Annotation score:

    Annotation score:2 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_055317326E → K2 PublicationsCorresponds to variant dbSNP:rs3755652Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0478381 – 450Missing in isoform 5. 1 PublicationAdd BLAST450
    Alternative sequenceiVSP_0478391 – 90Missing in isoform 3 and isoform 4. 2 PublicationsAdd BLAST90
    Alternative sequenceiVSP_0478401 – 11MERFRLEKKLP → MEADGAGEQMRPLLTR in isoform 6, isoform 9, isoform 10, isoform 11 and isoform 12. 1 PublicationAdd BLAST11
    Alternative sequenceiVSP_0478411 – 11MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR in isoform 7, isoform 8, isoform 13 and isoform 14. 2 PublicationsAdd BLAST11
    Alternative sequenceiVSP_04784291 – 118SQRVQ…TEMDE → MAVTQFIHFREEIMGNMFFI IIFSTKDK in isoform 3 and isoform 4. 2 PublicationsAdd BLAST28
    Alternative sequenceiVSP_047843238 – 250Missing in isoform 8, isoform 10 and isoform 12. 1 PublicationAdd BLAST13
    Alternative sequenceiVSP_047844251 – 374Missing in isoform 2, isoform 3, isoform 4, isoform 6, isoform 9, isoform 11, isoform 13 and isoform 14. 5 PublicationsAdd BLAST124
    Alternative sequenceiVSP_047845451 – 465PAVLL…VPVPT → MEVVEAEKIVLLTSA in isoform 5. 1 PublicationAdd BLAST15
    Alternative sequenceiVSP_047846581 – 582LF → VQ in isoform 10, isoform 11 and isoform 14. 2 Publications2
    Alternative sequenceiVSP_047847583 – 1214Missing in isoform 10, isoform 11 and isoform 14. 2 PublicationsAdd BLAST632
    Alternative sequenceiVSP_0478481188S → SVDPSIVNISDEMAKTAQWK ALSMNTENAKVTRSNMS in isoform 5, isoform 6, isoform 7, isoform 8 and isoform 13. 3 Publications1
    Alternative sequenceiVSP_0478491189 – 1214PDKPV…AETSL → GDPSIGNISDEMAKTAQWKA LSMNTENAKVTRSNMSPDKP VSVK in isoform 3. 1 PublicationAdd BLAST26

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    AB012130 mRNA Translation: BAA25898.1
    AF047033 mRNA Translation: AAD38322.1
    AF089726 mRNA Translation: AAG16773.1
    AF053755 mRNA Translation: AAF21720.1
    EU499349 mRNA Translation: ACB47400.1
    EU934246 mRNA Translation: ACH61958.1
    EU934248 mRNA Translation: ACH61960.1
    EU934249 mRNA Translation: ACH61961.1
    EU934250 mRNA Translation: ACH61962.1
    FJ178574 mRNA Translation: ACI24740.1
    FJ178575 mRNA Translation: ACI24741.1
    FJ178576 mRNA Translation: ACI24742.1
    GU354307 mRNA Translation: ADC32649.1
    GU354308 mRNA Translation: ADC32650.1
    GU354309 mRNA Translation: ADC32651.1
    GU354310 mRNA Translation: ADC32652.1
    CR627428 mRNA Translation: CAH10515.1
    AC099535 Genomic DNA No translation available.
    CH471055 Genomic DNA Translation: EAW64382.1

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS33721.1 [Q9Y6M7-1]
    CCDS58819.1 [Q9Y6M7-2]
    CCDS58820.1 [Q9Y6M7-6]
    CCDS82747.1 [Q9Y6M7-7]
    CCDS82749.1 [Q9Y6M7-8]
    CCDS82750.1 [Q9Y6M7-9]
    CCDS82751.1 [Q9Y6M7-12]

    Protein sequence database of the Protein Information Resource

    More...
    PIRi
    JE0160

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001245308.1, NM_001258379.1 [Q9Y6M7-6]
    NP_001245309.1, NM_001258380.1 [Q9Y6M7-2]
    NP_001308032.1, NM_001321103.1 [Q9Y6M7-7]
    NP_001308033.1, NM_001321104.1 [Q9Y6M7-8]
    NP_001308034.1, NM_001321105.1
    NP_001308035.1, NM_001321106.1 [Q9Y6M7-12]
    NP_001308036.1, NM_001321107.1 [Q9Y6M7-9]
    NP_001308037.1, NM_001321108.1 [Q9Y6M7-13]
    NP_003606.3, NM_003615.4 [Q9Y6M7-1]
    XP_016863017.1, XM_017007528.1 [Q9Y6M7-5]
    XP_016863018.1, XM_017007529.1 [Q9Y6M7-5]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000295736; ENSP00000295736; ENSG00000033867 [Q9Y6M7-1]
    ENST00000428386; ENSP00000416368; ENSG00000033867 [Q9Y6M7-2]
    ENST00000437179; ENSP00000394252; ENSG00000033867 [Q9Y6M7-9]
    ENST00000437266; ENSP00000409418; ENSG00000033867 [Q9Y6M7-11]
    ENST00000438530; ENSP00000407304; ENSG00000033867 [Q9Y6M7-10]
    ENST00000440156; ENSP00000414797; ENSG00000033867 [Q9Y6M7-8]
    ENST00000446700; ENSP00000406605; ENSG00000033867 [Q9Y6M7-12]
    ENST00000454389; ENSP00000390394; ENSG00000033867 [Q9Y6M7-7]
    ENST00000455077; ENSP00000407382; ENSG00000033867 [Q9Y6M7-6]
    ENST00000457377; ENSP00000408323; ENSG00000033867 [Q9Y6M7-11]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    9497

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:9497

    UCSC genome browser

    More...
    UCSCi
    uc003cdu.6 human [Q9Y6M7-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AB012130 mRNA Translation: BAA25898.1
    AF047033 mRNA Translation: AAD38322.1
    AF089726 mRNA Translation: AAG16773.1
    AF053755 mRNA Translation: AAF21720.1
    EU499349 mRNA Translation: ACB47400.1
    EU934246 mRNA Translation: ACH61958.1
    EU934248 mRNA Translation: ACH61960.1
    EU934249 mRNA Translation: ACH61961.1
    EU934250 mRNA Translation: ACH61962.1
    FJ178574 mRNA Translation: ACI24740.1
    FJ178575 mRNA Translation: ACI24741.1
    FJ178576 mRNA Translation: ACI24742.1
    GU354307 mRNA Translation: ADC32649.1
    GU354308 mRNA Translation: ADC32650.1
    GU354309 mRNA Translation: ADC32651.1
    GU354310 mRNA Translation: ADC32652.1
    CR627428 mRNA Translation: CAH10515.1
    AC099535 Genomic DNA No translation available.
    CH471055 Genomic DNA Translation: EAW64382.1
    CCDSiCCDS33721.1 [Q9Y6M7-1]
    CCDS58819.1 [Q9Y6M7-2]
    CCDS58820.1 [Q9Y6M7-6]
    CCDS82747.1 [Q9Y6M7-7]
    CCDS82749.1 [Q9Y6M7-8]
    CCDS82750.1 [Q9Y6M7-9]
    CCDS82751.1 [Q9Y6M7-12]
    PIRiJE0160
    RefSeqiNP_001245308.1, NM_001258379.1 [Q9Y6M7-6]
    NP_001245309.1, NM_001258380.1 [Q9Y6M7-2]
    NP_001308032.1, NM_001321103.1 [Q9Y6M7-7]
    NP_001308033.1, NM_001321104.1 [Q9Y6M7-8]
    NP_001308034.1, NM_001321105.1
    NP_001308035.1, NM_001321106.1 [Q9Y6M7-12]
    NP_001308036.1, NM_001321107.1 [Q9Y6M7-9]
    NP_001308037.1, NM_001321108.1 [Q9Y6M7-13]
    NP_003606.3, NM_003615.4 [Q9Y6M7-1]
    XP_016863017.1, XM_017007528.1 [Q9Y6M7-5]
    XP_016863018.1, XM_017007529.1 [Q9Y6M7-5]

    3D structure databases

    SMRiQ9Y6M7
    ModBaseiSearch...

    Protein-protein interaction databases

    BioGridi114876, 43 interactors
    IntActiQ9Y6M7, 14 interactors
    MINTiQ9Y6M7
    STRINGi9606.ENSP00000295736

    Chemistry databases

    ChEMBLiCHEMBL3774290
    DrugBankiDB01390 Sodium bicarbonate

    Protein family/group databases

    TCDBi2.A.31.2.11 the anion exchanger (ae) family

    PTM databases

    iPTMnetiQ9Y6M7
    PhosphoSitePlusiQ9Y6M7
    SwissPalmiQ9Y6M7

    Polymorphism and mutation databases

    BioMutaiSLC4A7
    DMDMi229462789

    Proteomic databases

    EPDiQ9Y6M7
    jPOSTiQ9Y6M7
    PaxDbiQ9Y6M7
    PeptideAtlasiQ9Y6M7
    PRIDEiQ9Y6M7
    ProteomicsDBi86734
    86735 [Q9Y6M7-2]
    86736 [Q9Y6M7-3]
    86737 [Q9Y6M7-4]
    86738 [Q9Y6M7-5]

    Protocols and materials databases

    The DNASU plasmid repository

    More...
    DNASUi
    9497
    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000295736; ENSP00000295736; ENSG00000033867 [Q9Y6M7-1]
    ENST00000428386; ENSP00000416368; ENSG00000033867 [Q9Y6M7-2]
    ENST00000437179; ENSP00000394252; ENSG00000033867 [Q9Y6M7-9]
    ENST00000437266; ENSP00000409418; ENSG00000033867 [Q9Y6M7-11]
    ENST00000438530; ENSP00000407304; ENSG00000033867 [Q9Y6M7-10]
    ENST00000440156; ENSP00000414797; ENSG00000033867 [Q9Y6M7-8]
    ENST00000446700; ENSP00000406605; ENSG00000033867 [Q9Y6M7-12]
    ENST00000454389; ENSP00000390394; ENSG00000033867 [Q9Y6M7-7]
    ENST00000455077; ENSP00000407382; ENSG00000033867 [Q9Y6M7-6]
    ENST00000457377; ENSP00000408323; ENSG00000033867 [Q9Y6M7-11]
    GeneIDi9497
    KEGGihsa:9497
    UCSCiuc003cdu.6 human [Q9Y6M7-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    9497
    DisGeNETi9497

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    SLC4A7

    H-Invitational Database, human transcriptome db

    More...
    H-InvDBi
    HIX0003134
    HGNCiHGNC:11033 SLC4A7
    HPAiCAB022494
    HPA035857
    MIMi603353 gene
    neXtProtiNX_Q9Y6M7
    OpenTargetsiENSG00000033867
    PharmGKBiPA35899

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiKOG1172 Eukaryota
    ENOG410XPHD LUCA
    GeneTreeiENSGT00940000157045
    HOGENOMiHOG000280684
    InParanoidiQ9Y6M7
    KOiK13858
    OMAiWSPIIAV
    OrthoDBi265068at2759
    PhylomeDBiQ9Y6M7
    TreeFamiTF313630

    Enzyme and pathway databases

    ReactomeiR-HSA-425381 Bicarbonate transporters

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    SLC4A7 human

    The Gene Wiki collection of pages on human genes and proteins

    More...
    GeneWikii
    SLC4A7

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    9497

    Protein Ontology

    More...
    PROi
    PR:Q9Y6M7

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000033867 Expressed in 218 organ(s), highest expression level in oocyte
    ExpressionAtlasiQ9Y6M7 baseline and differential
    GenevisibleiQ9Y6M7 HS

    Family and domain databases

    Gene3Di3.40.930.10, 2 hits
    InterProiView protein in InterPro
    IPR013769 Band3_cytoplasmic_dom
    IPR011531 HCO3_transpt_C
    IPR003020 HCO3_transpt_euk
    IPR016152 PTrfase/Anion_transptr
    PANTHERiPTHR11453 PTHR11453, 1 hit
    PfamiView protein in Pfam
    PF07565 Band_3_cyto, 1 hit
    PF00955 HCO3_cotransp, 1 hit
    PRINTSiPR01231 HCO3TRNSPORT
    SUPFAMiSSF55804 SSF55804, 2 hits
    TIGRFAMsiTIGR00834 ae, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiS4A7_HUMAN
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y6M7
    Secondary accession number(s): A6NIA8
    , B2CI53, B5M449, B5M451, B5M452, B5M453, B6DY52, B6DY53, C9JST9, D3K174, D3K175, O60350, Q6AHZ9, Q9HC88, Q9UIB9
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 7, 2006
    Last sequence update: May 5, 2009
    Last modified: May 8, 2019
    This is version 158 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families
    2. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again