Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 175 (25 May 2022)
Sequence version 2 (05 May 2009)
Previous versions | rss
Add a publicationFeedback
Protein

Sodium bicarbonate cotransporter 3

Gene

SLC4A7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Electroneutral sodium- and bicarbonate-dependent cotransporter with a Na+:HCO3- 1:1 stoichiometry. Regulates intracellular pH and may play a role in bicarbonate salvage in secretory epithelia. May also have an associated sodium channel activity.

2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Transporter activity is regulated by CA2/carbonic anhydrase 2, cAMP and PKA. Insensitive to stilbene derivatives. PubMed:10347222 states it is inhibited by 5-(N-ethyl-N-isopropyl)-amiloride (EIPA).

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=24 mM for external sodium1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processIon transport, Sodium transport, Symport, Transport
LigandSodium

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9Y6M7

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-425381, Bicarbonate transporters
R-HSA-9013405, RHOD GTPase cycle
R-HSA-9013406, RHOQ GTPase cycle
R-HSA-9013407, RHOH GTPase cycle
R-HSA-9013409, RHOJ GTPase cycle
R-HSA-9035034, RHOF GTPase cycle

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9Y6M7

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.31.2.11, the anion exchanger (ae) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sodium bicarbonate cotransporter 3
Alternative name(s):
Electroneutral Na/HCO(3) cotransporter
Sodium bicarbonate cotransporter 2
Sodium bicarbonate cotransporter 2b
Short name:
Bicarbonate transporter
Solute carrier family 4 member 7
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC4A7
Synonyms:BT, NBC2, NBC2B, NBC3, NBCn1, SBC2, SLC4A6
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11033, SLC4A7

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603353, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y6M7

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000033867

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 608ExtracellularSequence analysisAdd BLAST608
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei609 – 629HelicalSequence analysisAdd BLAST21
Topological domaini630 – 637CytoplasmicSequence analysis8
Transmembranei638 – 658HelicalSequence analysisAdd BLAST21
Topological domaini659 – 695ExtracellularSequence analysisAdd BLAST37
Transmembranei696 – 716HelicalSequence analysisAdd BLAST21
Topological domaini717 – 725CytoplasmicSequence analysis9
Transmembranei726 – 746HelicalSequence analysisAdd BLAST21
Topological domaini747 – 817ExtracellularSequence analysisAdd BLAST71
Transmembranei818 – 838HelicalSequence analysisAdd BLAST21
Topological domaini839 – 861CytoplasmicSequence analysisAdd BLAST23
Transmembranei862 – 882HelicalSequence analysisAdd BLAST21
Topological domaini883 – 908ExtracellularSequence analysisAdd BLAST26
Transmembranei909 – 929HelicalSequence analysisAdd BLAST21
Topological domaini930 – 954CytoplasmicSequence analysisAdd BLAST25
Transmembranei955 – 975HelicalSequence analysisAdd BLAST21
Topological domaini976 – 1011ExtracellularSequence analysisAdd BLAST36
Transmembranei1012 – 1032HelicalSequence analysisAdd BLAST21
Topological domaini1033 – 1034CytoplasmicSequence analysis2
Transmembranei1035 – 1055HelicalSequence analysisAdd BLAST21
Topological domaini1056 – 1092ExtracellularSequence analysisAdd BLAST37
Transmembranei1093 – 1113HelicalSequence analysisAdd BLAST21
Topological domaini1114 – 1214CytoplasmicSequence analysisAdd BLAST101

Keywords - Cellular componenti

Cell membrane, Cell projection, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1135 – 1136DD → NN: Loss of interaction with CA2. Loss of regulation by CA2. 1 Publication2
Mutagenesisi1163 – 1165DDD → NNN: No effect on interaction with CA2. No effect on regulation by CA2. 1 Publication3
Mutagenesisi1214L → G: Loss of interaction with ATP6V1B1. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
9497

Open Targets

More...
OpenTargetsi
ENSG00000033867

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA35899

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9Y6M7, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3774290

Drug and drug target database

More...
DrugBanki
DB01390, Sodium bicarbonate

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SLC4A7

Domain mapping of disease mutations (DMDM)

More...
DMDMi
229462789

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000792331 – 1214Sodium bicarbonate cotransporter 3Add BLAST1214

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei52PhosphoserineBy similarity1
Modified residuei55PhosphoserineCombined sources1
Modified residuei84PhosphoserineBy similarity1
Modified residuei150PhosphoserineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi171N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei233PhosphoserineBy similarity1
Modified residuei242PhosphoserineCombined sources1
Glycosylationi269N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei382PhosphoserineBy similarity1
Glycosylationi398N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei400PhosphoserineBy similarity1
Modified residuei403PhosphoserineCombined sources1
Glycosylationi406N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei407PhosphoserineCombined sources1
Modified residuei556PhosphoserineCombined sources1
Modified residuei557PhosphothreonineCombined sources1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi766 ↔ 768By similarity
Glycosylationi776N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi786N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi791N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi802 ↔ 814By similarity
Modified residuei1167PhosphothreonineCombined sources1
Modified residuei1176PhosphoserineCombined sources1
Modified residuei1213PhosphoserineCombined sources1
Isoform 3 (identifier: Q9Y6M7-3)
Modified residuei165PhosphoserineCombined sources1
Modified residuei168PhosphoserineCombined sources1
Modified residuei1007PhosphoserineCombined sources1
Modified residuei1010PhosphoserineCombined sources1
Modified residuei1016PhosphoserineCombined sources1
Isoform 4 (identifier: Q9Y6M7-4)
Modified residuei165PhosphoserineCombined sources1
Modified residuei168PhosphoserineCombined sources1
Isoform 2 (identifier: Q9Y6M7-2)
Modified residuei255PhosphoserineCombined sources1
Modified residuei258PhosphoserineCombined sources1
Isoform 6 (identifier: Q9Y6M7-6)
Modified residuei260PhosphoserineCombined sources1
Modified residuei263PhosphoserineCombined sources1
Modified residuei1073PhosphoserineCombined sources1
Modified residuei1102PhosphoserineCombined sources1
Modified residuei1105PhosphoserineCombined sources1
Modified residuei1111PhosphoserineCombined sources1
Isoform 9 (identifier: Q9Y6M7-9)
Modified residuei260PhosphoserineCombined sources1
Modified residuei263PhosphoserineCombined sources1
Isoform 11 (identifier: Q9Y6M7-11)
Modified residuei260PhosphoserineCombined sources1
Modified residuei263PhosphoserineCombined sources1
Isoform 13 (identifier: Q9Y6M7-13)
Modified residuei264PhosphoserineCombined sources1
Modified residuei267PhosphoserineCombined sources1
Modified residuei1077PhosphoserineCombined sources1
Modified residuei1106PhosphoserineCombined sources1
Modified residuei1109PhosphoserineCombined sources1
Modified residuei1115PhosphoserineCombined sources1
Isoform 14 (identifier: Q9Y6M7-14)
Modified residuei264PhosphoserineCombined sources1
Modified residuei267PhosphoserineCombined sources1
Isoform 5 (identifier: Q9Y6M7-5)
Modified residuei742PhosphoserineCombined sources1
Modified residuei771PhosphoserineCombined sources1
Modified residuei774PhosphoserineCombined sources1
Modified residuei780PhosphoserineCombined sources1
Isoform 8 (identifier: Q9Y6M7-8)
Modified residuei1188PhosphoserineCombined sources1
Modified residuei1217PhosphoserineCombined sources1
Modified residuei1220PhosphoserineCombined sources1
Modified residuei1226PhosphoserineCombined sources1
Isoform 7 (identifier: Q9Y6M7-7)
Modified residuei1201PhosphoserineCombined sources1
Modified residuei1230PhosphoserineCombined sources1
Modified residuei1233PhosphoserineCombined sources1
Modified residuei1239PhosphoserineCombined sources1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9Y6M7

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9Y6M7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9Y6M7

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9Y6M7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y6M7

PeptideAtlas

More...
PeptideAtlasi
Q9Y6M7

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y6M7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
12778
3404
5941
5942
6243
6244
86734 [Q9Y6M7-1]
86735 [Q9Y6M7-2]
86736 [Q9Y6M7-3]
86737 [Q9Y6M7-4]
86738 [Q9Y6M7-5]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q9Y6M7, 9 sites, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y6M7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y6M7

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9Y6M7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in testis and spleen. Also expressed in retina, colon, small intestine, ovary, thymus, prostate, muscle, heart and kidney. Isoform 1 is expressed in skeletal muscle and heart muscle.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000033867, Expressed in oocyte and 229 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9Y6M7, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Y6M7, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000033867, Tissue enhanced (intestine, retina)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CFTR through SLC9A3R1/EBP50.

Interacts with USH1C.

Forms a complex with ATP6V1B1 and SLC9A3R1/EBP50.

Interacts in a pH dependent-manner with CA2/carbonic anhydrase 2.

4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
114876, 150 interactors

Protein interaction database and analysis system

More...
IntActi
Q9Y6M7, 50 interactors

Molecular INTeraction database

More...
MINTi
Q9Y6M7

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000295736

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9Y6M7, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

AlphaFold Protein Structure Database

More...
AlphaFoldDBi
Q9Y6M7

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Y6M7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 22DisorderedSequence analysisAdd BLAST22
Regioni52 – 93DisorderedSequence analysisAdd BLAST42
Regioni289 – 346DisorderedSequence analysisAdd BLAST58
Regioni362 – 408DisorderedSequence analysisAdd BLAST47
Regioni552 – 572DisorderedSequence analysisAdd BLAST21
Regioni1134 – 1136CA2-binding3
Regioni1144 – 1169DisorderedSequence analysisAdd BLAST26

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi1211 – 1214PDZ-binding4

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1 – 16Basic and acidic residuesSequence analysisAdd BLAST16
Compositional biasi53 – 72Basic residuesSequence analysisAdd BLAST20
Compositional biasi312 – 334Polar residuesSequence analysisAdd BLAST23
Compositional biasi375 – 408Polar residuesSequence analysisAdd BLAST34

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PDZ-binding motif mediates interaction with the CFTR, SLC9A3R1/EBP50 complex and probably with USH1C.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1172, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157045

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_002289_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y6M7

Identification of Orthologs from Complete Genome Data

More...
OMAi
TEENFAC

Database of Orthologous Groups

More...
OrthoDBi
863978at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y6M7

TreeFam database of animal gene trees

More...
TreeFami
TF313630

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.930.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013769, Band3_cytoplasmic_dom
IPR011531, HCO3_transpt-like_TM_dom
IPR003020, HCO3_transpt_euk
IPR016152, PTrfase/Anion_transptr

The PANTHER Classification System

More...
PANTHERi
PTHR11453, PTHR11453, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07565, Band_3_cyto, 2 hits
PF00955, HCO3_cotransp, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01231, HCO3TRNSPORT

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF55804, SSF55804, 2 hits

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00834, ae, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (14+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 14 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 14 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y6M7-1) [UniParc]FASTAAdd to basket
Also known as: mNBC3, NBCn1-A

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MERFRLEKKL PGPDEEAVVD LGKTSSTVNT KFEKEELESH RAVYIGVHVP
60 70 80 90 100
FSKESRRRHR HRGHKHHHRR RKDKESDKED GRESPSYDTP SQRVQFILGT
110 120 130 140 150
EDDDEEHIPH DLFTEMDELC YRDGEEYEWK ETARWLKFEE DVEDGGDRWS
160 170 180 190 200
KPYVATLSLH SLFELRSCIL NGTVMLDMRA STLDEIADMV LDNMIASGQL
210 220 230 240 250
DESIRENVRE ALLKRHHHQN EKRFTSRIPL VRSFADIGKK HSDPHLLERN
260 270 280 290 300
GEGLSASRHS LRTGLSASNL SLRGESPLSL LLGHLLPSSR AGTPAGSRCT
310 320 330 340 350
TPVPTPQNSP PSSPSISRLT SRSSQESQRQ APELLVSPAS DDIPTVVIHP
360 370 380 390 400
PEEDLEAALK GEEQKNEENV DLTPGILASP QSAPGNLDNS KSGEIKGNGS
410 420 430 440 450
GGSRENSTVD FSKVDMNFMR KIPTGAEASN VLVGEVDFLE RPIIAFVRLA
460 470 480 490 500
PAVLLTGLTE VPVPTRFLFL LLGPAGKAPQ YHEIGRSIAT LMTDEIFHDV
510 520 530 540 550
AYKAKDRNDL LSGIDEFLDQ VTVLPPGEWD PSIRIEPPKS VPSQEKRKIP
560 570 580 590 600
VFHNGSTPTL GETPKEAAHH AGPELQRTGR LFGGLILDIK RKAPFFLSDF
610 620 630 640 650
KDALSLQCLA SILFLYCACM SPVITFGGLL GEATEGRISA IESLFGASLT
660 670 680 690 700
GIAYSLFAGQ PLTILGSTGP VLVFEKILYK FCRDYQLSYL SLRTSIGLWT
710 720 730 740 750
SFLCIVLVAT DASSLVCYIT RFTEEAFAAL ICIIFIYEAL EKLFDLGETY
760 770 780 790 800
AFNMHNNLDK LTSYSCVCTE PPNPSNETLA QWKKDNITAH NISWRNLTVS
810 820 830 840 850
ECKKLRGVFL GSACGHHGPY IPDVLFWCVI LFFTTFFLSS FLKQFKTKRY
860 870 880 890 900
FPTKVRSTIS DFAVFLTIVI MVTIDYLVGV PSPKLHVPEK FEPTHPERGW
910 920 930 940 950
IISPLGDNPW WTLLIAAIPA LLCTILIFMD QQITAVIINR KEHKLKKGAG
960 970 980 990 1000
YHLDLLMVGV MLGVCSVMGL PWFVAATVLS ISHVNSLKVE SECSAPGEQP
1010 1020 1030 1040 1050
KFLGIREQRV TGLMIFILMG LSVFMTSVLK FIPMPVLYGV FLYMGVSSLK
1060 1070 1080 1090 1100
GIQLFDRIKL FGMPAKHQPD LIYLRYVPLW KVHIFTVIQL TCLVLLWVIK
1110 1120 1130 1140 1150
VSAAAVVFPM MVLALVFVRK LMDLCFTKRE LSWLDDLMPE SKKKKEDDKK
1160 1170 1180 1190 1200
KKEKEEAERM LQDDDDTVHL PFEGGSLLQI PVKALKYSPD KPVSVKISFE
1210
DEPRKKYVDA ETSL
Length:1,214
Mass (Da):136,044
Last modified:May 5, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7B4ADA1E3F26813C
GO
Isoform 2 (identifier: Q9Y6M7-2) [UniParc]FASTAAdd to basket
Also known as: NBCn1-F

The sequence of this isoform differs from the canonical sequence as follows:
     251-374: Missing.

Show »
Length:1,090
Mass (Da):123,081
Checksum:i541839CC9B565896
GO
Isoform 3 (identifier: Q9Y6M7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-90: Missing.
     91-118: SQRVQFILGTEDDDEEHIPHDLFTEMDE → MAVTQFIHFREEIMGNMFFIIIFSTKDK
     251-374: Missing.
     1189-1214: PDKPVSVKISFEDEPRKKYVDAETSL → GDPSIGNISDEMAKTAQWKALSMNTENAKVTRSNMSPDKPVSVK

Show »
Length:1,018
Mass (Da):114,205
Checksum:iA37799D93A1E30BC
GO
Isoform 4 (identifier: Q9Y6M7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-90: Missing.
     91-118: SQRVQFILGTEDDDEEHIPHDLFTEMDE → MAVTQFIHFREEIMGNMFFIIIFSTKDK
     251-374: Missing.

Show »
Length:1,000
Mass (Da):112,448
Checksum:i50FAA40A31468223
GO
Isoform 5 (identifier: Q9Y6M7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-450: Missing.
     451-465: PAVLLTGLTEVPVPT → MEVVEAEKIVLLTSA
     1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

Show »
Length:800
Mass (Da):89,745
Checksum:iD7FB5D3479BB0935
GO
Isoform 6 (identifier: Q9Y6M7-6) [UniParc]FASTAAdd to basket
Also known as: NBCn1-G

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
     251-374: Missing.
     1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

Show »
Length:1,131
Mass (Da):127,359
Checksum:iD3DC49DE4DD7F133
GO
Isoform 7 (identifier: Q9Y6M7-7) [UniParc]FASTAAdd to basket
Also known as: NBCn1-D

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR
     1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

Show »
Length:1,259
Mass (Da):140,766
Checksum:iDDE8C01EB6C6E00F
GO
Isoform 8 (identifier: Q9Y6M7-8) [UniParc]FASTAAdd to basket
Also known as: NBCn1-C

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR
     238-250: Missing.
     1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

Show »
Length:1,246
Mass (Da):139,254
Checksum:iDEA67883267065E6
GO
Isoform 9 (identifier: Q9Y6M7-9) [UniParc]FASTAAdd to basket
Also known as: NBCn1-E

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
     251-374: Missing.

Show »
Length:1,095
Mass (Da):123,409
Checksum:iA3CD8C2972A7DFB3
GO
Isoform 10 (identifier: Q9Y6M7-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
     238-250: Missing.
     581-582: LF → VQ
     583-1214: Missing.

Show »
Length:574
Mass (Da):63,699
Checksum:i57ECD93FDB48A158
GO
Isoform 11 (identifier: Q9Y6M7-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
     251-374: Missing.
     581-582: LF → VQ
     583-1214: Missing.

Show »
Length:463
Mass (Da):52,249
Checksum:iBFD9ACB2B9362149
GO
Isoform 12 (identifier: Q9Y6M7-12) [UniParc]FASTAAdd to basket
Also known as: NBCn1-H

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MERFRLEKKLP → MEADGAGEQMRPLLTR
     238-250: Missing.

Show »
Length:1,206
Mass (Da):134,860
Checksum:i8A29DF5AD5ECE7E6
GO
Isoform 13 (identifier: Q9Y6M7-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR
     251-374: Missing.
     1188-1188: S → SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS

Show »
Length:1,135
Mass (Da):127,803
Checksum:i77E065DA75256869
GO
Isoform 14 (identifier: Q9Y6M7-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR
     251-374: Missing.
     581-582: LF → VQ
     583-1214: Missing.

Show »
Length:467
Mass (Da):52,692
Checksum:i80F478ACDCBA905A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PFN4E9PFN4_HUMAN
Anion exchange protein
SLC4A7
1,210Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JRP1C9JRP1_HUMAN
Anion exchange protein
SLC4A7
1,051Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C3C4H7C3C4_HUMAN
Anion exchange protein
SLC4A7
801Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MST8A0A0A0MST8_HUMAN
Anion exchange protein
SLC4A7
1,201Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_055317326E → K2 PublicationsCorresponds to variant dbSNP:rs3755652Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0478381 – 450Missing in isoform 5. 1 PublicationAdd BLAST450
Alternative sequenceiVSP_0478391 – 90Missing in isoform 3 and isoform 4. 2 PublicationsAdd BLAST90
Alternative sequenceiVSP_0478401 – 11MERFRLEKKLP → MEADGAGEQMRPLLTR in isoform 6, isoform 9, isoform 10, isoform 11 and isoform 12. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_0478411 – 11MERFRLEKKLP → MEADGAGEQMRPLLTRVTSR in isoform 7, isoform 8, isoform 13 and isoform 14. 2 PublicationsAdd BLAST11
Alternative sequenceiVSP_04784291 – 118SQRVQ…TEMDE → MAVTQFIHFREEIMGNMFFI IIFSTKDK in isoform 3 and isoform 4. 2 PublicationsAdd BLAST28
Alternative sequenceiVSP_047843238 – 250Missing in isoform 8, isoform 10 and isoform 12. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_047844251 – 374Missing in isoform 2, isoform 3, isoform 4, isoform 6, isoform 9, isoform 11, isoform 13 and isoform 14. 5 PublicationsAdd BLAST124
Alternative sequenceiVSP_047845451 – 465PAVLL…VPVPT → MEVVEAEKIVLLTSA in isoform 5. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_047846581 – 582LF → VQ in isoform 10, isoform 11 and isoform 14. 2 Publications2
Alternative sequenceiVSP_047847583 – 1214Missing in isoform 10, isoform 11 and isoform 14. 2 PublicationsAdd BLAST632
Alternative sequenceiVSP_0478481188S → SVDPSIVNISDEMAKTAQWK ALSMNTENAKVTRSNMS in isoform 5, isoform 6, isoform 7, isoform 8 and isoform 13. 3 Publications1
Alternative sequenceiVSP_0478491189 – 1214PDKPV…AETSL → GDPSIGNISDEMAKTAQWKA LSMNTENAKVTRSNMSPDKP VSVK in isoform 3. 1 PublicationAdd BLAST26

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB012130 mRNA Translation: BAA25898.1
AF047033 mRNA Translation: AAD38322.1
AF089726 mRNA Translation: AAG16773.1
AF053755 mRNA Translation: AAF21720.1
EU499349 mRNA Translation: ACB47400.1
EU934246 mRNA Translation: ACH61958.1
EU934248 mRNA Translation: ACH61960.1
EU934249 mRNA Translation: ACH61961.1
EU934250 mRNA Translation: ACH61962.1
FJ178574 mRNA Translation: ACI24740.1
FJ178575 mRNA Translation: ACI24741.1
FJ178576 mRNA Translation: ACI24742.1
GU354307 mRNA Translation: ADC32649.1
GU354308 mRNA Translation: ADC32650.1
GU354309 mRNA Translation: ADC32651.1
GU354310 mRNA Translation: ADC32652.1
CR627428 mRNA Translation: CAH10515.1
AC099535 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64382.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS33721.1 [Q9Y6M7-1]
CCDS58819.1 [Q9Y6M7-2]
CCDS58820.1 [Q9Y6M7-6]
CCDS82747.1 [Q9Y6M7-7]
CCDS82749.1 [Q9Y6M7-8]
CCDS82750.1 [Q9Y6M7-9]
CCDS82751.1 [Q9Y6M7-12]

Protein sequence database of the Protein Information Resource

More...
PIRi
JE0160

NCBI Reference Sequences

More...
RefSeqi
NP_001245308.1, NM_001258379.1 [Q9Y6M7-6]
NP_001245309.1, NM_001258380.1 [Q9Y6M7-2]
NP_001308032.1, NM_001321103.1 [Q9Y6M7-7]
NP_001308033.1, NM_001321104.1 [Q9Y6M7-8]
NP_001308034.1, NM_001321105.1
NP_001308035.1, NM_001321106.1 [Q9Y6M7-12]
NP_001308036.1, NM_001321107.1 [Q9Y6M7-9]
NP_001308037.1, NM_001321108.1 [Q9Y6M7-13]
NP_003606.3, NM_003615.4 [Q9Y6M7-1]
XP_016863017.1, XM_017007528.1 [Q9Y6M7-5]
XP_016863018.1, XM_017007529.1 [Q9Y6M7-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000295736.9; ENSP00000295736.5; ENSG00000033867.17
ENST00000428386.5; ENSP00000416368.1; ENSG00000033867.17 [Q9Y6M7-2]
ENST00000437179.5; ENSP00000394252.1; ENSG00000033867.17 [Q9Y6M7-9]
ENST00000437266.5; ENSP00000409418.1; ENSG00000033867.17 [Q9Y6M7-11]
ENST00000438530.5; ENSP00000407304.1; ENSG00000033867.17 [Q9Y6M7-10]
ENST00000440156.5; ENSP00000414797.1; ENSG00000033867.17 [Q9Y6M7-8]
ENST00000446700.5; ENSP00000406605.1; ENSG00000033867.17 [Q9Y6M7-12]
ENST00000454389.6; ENSP00000390394.1; ENSG00000033867.17 [Q9Y6M7-7]
ENST00000455077.5; ENSP00000407382.1; ENSG00000033867.17 [Q9Y6M7-6]
ENST00000457377.5; ENSP00000408323.1; ENSG00000033867.17 [Q9Y6M7-11]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9497

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9497

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...
MANE-Selecti
ENST00000454389.6; ENSP00000390394.1; NM_001321103.2; NP_001308032.1 [Q9Y6M7-7]

UCSC genome browser

More...
UCSCi
uc003cdu.6, human [Q9Y6M7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB012130 mRNA Translation: BAA25898.1
AF047033 mRNA Translation: AAD38322.1
AF089726 mRNA Translation: AAG16773.1
AF053755 mRNA Translation: AAF21720.1
EU499349 mRNA Translation: ACB47400.1
EU934246 mRNA Translation: ACH61958.1
EU934248 mRNA Translation: ACH61960.1
EU934249 mRNA Translation: ACH61961.1
EU934250 mRNA Translation: ACH61962.1
FJ178574 mRNA Translation: ACI24740.1
FJ178575 mRNA Translation: ACI24741.1
FJ178576 mRNA Translation: ACI24742.1
GU354307 mRNA Translation: ADC32649.1
GU354308 mRNA Translation: ADC32650.1
GU354309 mRNA Translation: ADC32651.1
GU354310 mRNA Translation: ADC32652.1
CR627428 mRNA Translation: CAH10515.1
AC099535 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64382.1
CCDSiCCDS33721.1 [Q9Y6M7-1]
CCDS58819.1 [Q9Y6M7-2]
CCDS58820.1 [Q9Y6M7-6]
CCDS82747.1 [Q9Y6M7-7]
CCDS82749.1 [Q9Y6M7-8]
CCDS82750.1 [Q9Y6M7-9]
CCDS82751.1 [Q9Y6M7-12]
PIRiJE0160
RefSeqiNP_001245308.1, NM_001258379.1 [Q9Y6M7-6]
NP_001245309.1, NM_001258380.1 [Q9Y6M7-2]
NP_001308032.1, NM_001321103.1 [Q9Y6M7-7]
NP_001308033.1, NM_001321104.1 [Q9Y6M7-8]
NP_001308034.1, NM_001321105.1
NP_001308035.1, NM_001321106.1 [Q9Y6M7-12]
NP_001308036.1, NM_001321107.1 [Q9Y6M7-9]
NP_001308037.1, NM_001321108.1 [Q9Y6M7-13]
NP_003606.3, NM_003615.4 [Q9Y6M7-1]
XP_016863017.1, XM_017007528.1 [Q9Y6M7-5]
XP_016863018.1, XM_017007529.1 [Q9Y6M7-5]

3D structure databases

AlphaFoldDBiQ9Y6M7
SMRiQ9Y6M7
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi114876, 150 interactors
IntActiQ9Y6M7, 50 interactors
MINTiQ9Y6M7
STRINGi9606.ENSP00000295736

Chemistry databases

ChEMBLiCHEMBL3774290
DrugBankiDB01390, Sodium bicarbonate

Protein family/group databases

TCDBi2.A.31.2.11, the anion exchanger (ae) family

PTM databases

GlyGeniQ9Y6M7, 9 sites, 1 O-linked glycan (1 site)
iPTMnetiQ9Y6M7
PhosphoSitePlusiQ9Y6M7
SwissPalmiQ9Y6M7

Genetic variation databases

BioMutaiSLC4A7
DMDMi229462789

Proteomic databases

EPDiQ9Y6M7
jPOSTiQ9Y6M7
MassIVEiQ9Y6M7
MaxQBiQ9Y6M7
PaxDbiQ9Y6M7
PeptideAtlasiQ9Y6M7
PRIDEiQ9Y6M7
ProteomicsDBi12778
3404
5941
5942
6243
6244
86734 [Q9Y6M7-1]
86735 [Q9Y6M7-2]
86736 [Q9Y6M7-3]
86737 [Q9Y6M7-4]
86738 [Q9Y6M7-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
45253, 182 antibodies from 25 providers

The DNASU plasmid repository

More...
DNASUi
9497

Genome annotation databases

EnsembliENST00000295736.9; ENSP00000295736.5; ENSG00000033867.17
ENST00000428386.5; ENSP00000416368.1; ENSG00000033867.17 [Q9Y6M7-2]
ENST00000437179.5; ENSP00000394252.1; ENSG00000033867.17 [Q9Y6M7-9]
ENST00000437266.5; ENSP00000409418.1; ENSG00000033867.17 [Q9Y6M7-11]
ENST00000438530.5; ENSP00000407304.1; ENSG00000033867.17 [Q9Y6M7-10]
ENST00000440156.5; ENSP00000414797.1; ENSG00000033867.17 [Q9Y6M7-8]
ENST00000446700.5; ENSP00000406605.1; ENSG00000033867.17 [Q9Y6M7-12]
ENST00000454389.6; ENSP00000390394.1; ENSG00000033867.17 [Q9Y6M7-7]
ENST00000455077.5; ENSP00000407382.1; ENSG00000033867.17 [Q9Y6M7-6]
ENST00000457377.5; ENSP00000408323.1; ENSG00000033867.17 [Q9Y6M7-11]
GeneIDi9497
KEGGihsa:9497
MANE-SelectiENST00000454389.6; ENSP00000390394.1; NM_001321103.2; NP_001308032.1 [Q9Y6M7-7]
UCSCiuc003cdu.6, human [Q9Y6M7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9497
DisGeNETi9497

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SLC4A7
HGNCiHGNC:11033, SLC4A7
HPAiENSG00000033867, Tissue enhanced (intestine, retina)
MIMi603353, gene
neXtProtiNX_Q9Y6M7
OpenTargetsiENSG00000033867
PharmGKBiPA35899
VEuPathDBiHostDB:ENSG00000033867

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1172, Eukaryota
GeneTreeiENSGT00940000157045
HOGENOMiCLU_002289_0_0_1
InParanoidiQ9Y6M7
OMAiTEENFAC
OrthoDBi863978at2759
PhylomeDBiQ9Y6M7
TreeFamiTF313630

Enzyme and pathway databases

PathwayCommonsiQ9Y6M7
ReactomeiR-HSA-425381, Bicarbonate transporters
R-HSA-9013405, RHOD GTPase cycle
R-HSA-9013406, RHOQ GTPase cycle
R-HSA-9013407, RHOH GTPase cycle
R-HSA-9013409, RHOJ GTPase cycle
R-HSA-9035034, RHOF GTPase cycle
SignaLinkiQ9Y6M7

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
9497, 243 hits in 1085 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SLC4A7, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SLC4A7

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9497
PharosiQ9Y6M7, Tbio

Protein Ontology

More...
PROi
PR:Q9Y6M7
RNActiQ9Y6M7, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000033867, Expressed in oocyte and 229 other tissues
ExpressionAtlasiQ9Y6M7, baseline and differential
GenevisibleiQ9Y6M7, HS

Family and domain databases

Gene3Di3.40.930.10, 1 hit
InterProiView protein in InterPro
IPR013769, Band3_cytoplasmic_dom
IPR011531, HCO3_transpt-like_TM_dom
IPR003020, HCO3_transpt_euk
IPR016152, PTrfase/Anion_transptr
PANTHERiPTHR11453, PTHR11453, 1 hit
PfamiView protein in Pfam
PF07565, Band_3_cyto, 2 hits
PF00955, HCO3_cotransp, 1 hit
PRINTSiPR01231, HCO3TRNSPORT
SUPFAMiSSF55804, SSF55804, 2 hits
TIGRFAMsiTIGR00834, ae, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiS4A7_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y6M7
Secondary accession number(s): A6NIA8
, B2CI53, B5M449, B5M451, B5M452, B5M453, B6DY52, B6DY53, C9JST9, D3K174, D3K175, O60350, Q6AHZ9, Q9HC88, Q9UIB9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 7, 2006
Last sequence update: May 5, 2009
Last modified: May 25, 2022
This is version 175 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again