Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9Y6K9 (NEMO_HUMAN)

Entry version 213 (10 Apr 2019)
Sequence version 2 (30 May 2000)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

NF-kappa-B essential modulator

Gene

IKBKG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulatory subunit of the IKK core complex which phosphorylates inhibitors of NF-kappa-B thus leading to the dissociation of the inhibitor/NF-kappa-B complex and ultimately the degradation of the inhibitor. Its binding to scaffolding polyubiquitin seems to play a role in IKK activation by multiple signaling receptor pathways. However, the specific type of polyubiquitin recognized upon cell stimulation (either 'Lys-63'-linked or linear polyubiquitin) and its functional importance is reported conflictingly. Also considered to be a mediator for TAX activation of NF-kappa-B. Could be implicated in NF-kappa-B-mediated protection from cytokine toxicity. Essential for viral activation of IRF3. Involved in TLR3- and IFIH1-mediated antiviral innate response; this function requires 'Lys-27'-linked polyubiquitination.3 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri389 – 419CCHC NOA-typePROSITE-ProRule annotationAdd BLAST31

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processDNA damage, Host-virus interaction, Transcription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-1169091 Activation of NF-kappaB in B cells
R-HSA-1236974 ER-Phagosome pathway
R-HSA-168638 NOD1/2 Signaling Pathway
R-HSA-168927 TICAM1, RIP1-mediated IKK complex recruitment
R-HSA-1810476 RIP-mediated NFkB activation via ZBP1
R-HSA-202424 Downstream TCR signaling
R-HSA-2871837 FCERI mediated NF-kB activation
R-HSA-445989 TAK1 activates NFkB by phosphorylation and activation of IKKs complex
R-HSA-450302 activated TAK1 mediates p38 MAPK activation
R-HSA-450321 JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1
R-HSA-4755510 SUMOylation of immune response proteins
R-HSA-5357905 Regulation of TNFR1 signaling
R-HSA-5357956 TNFR1-induced NFkappaB signaling pathway
R-HSA-5602636 IKBKB deficiency causes SCID
R-HSA-5603027 IKBKG deficiency causes anhidrotic ectodermal dysplasia with immunodeficiency (EDA-ID) (via TLR)
R-HSA-5603029 IkBA variant leads to EDA-ID
R-HSA-5607764 CLEC7A (Dectin-1) signaling
R-HSA-5684264 MAP3K8 (TPL2)-dependent MAPK1/3 activation
R-HSA-5689880 Ub-specific processing proteases
R-HSA-5689896 Ovarian tumor domain proteases
R-HSA-9020702 Interleukin-1 signaling
R-HSA-933542 TRAF6 mediated NF-kB activation
R-HSA-933543 NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10
R-HSA-937039 IRAK1 recruits IKK complex
R-HSA-937041 IKK complex recruitment mediated by RIP1
R-HSA-975144 IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation

SABIO-RK: Biochemical Reaction Kinetics Database

More...SABIO-RKi		Q9Y6K9

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q9Y6K9

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...MoonDBi		Q9Y6K9 Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
NF-kappa-B essential modulator
Short name:
NEMO
Alternative name(s):
FIP-3
IkB kinase-associated protein 1
Short name:
IKKAP1
Inhibitor of nuclear factor kappa-B kinase subunit gamma
Short name:
I-kappa-B kinase subunit gamma
Short name:
IKK-gamma
Short name:
IKKG
Short name:
IkB kinase subunit gamma
NF-kappa-B essential modifier
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:IKBKG
Synonyms:FIP3, NEMO
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000269335.5

Human Gene Nomenclature Database

More...HGNCi		HGNC:5961 IKBKG

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		300248 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9Y6K9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Ectodermal dysplasia, anhidrotic, with immunodeficiency X-linked (EDAID)9 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of ectoderma dysplasia, a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. Characterized by absence of sweat glands, sparse scalp hair, rare conical teeth and immunological abnormalities resulting in severe infectious diseases.
See also OMIM:300291
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_026495153L → R in EDAID. 2 PublicationsCorresponds to variant dbSNP:rs137853328EnsemblClinVar.1
Natural variantiVAR_011320175R → P in EDAID. 1 PublicationCorresponds to variant dbSNP:rs179363868EnsemblClinVar.1
Natural variantiVAR_011321227L → P in EDAID. 1 PublicationCorresponds to variant dbSNP:rs179363869EnsemblClinVar.1
Natural variantiVAR_011322288A → G in EDAID. 1 PublicationCorresponds to variant dbSNP:rs137853330EnsemblClinVar.1
Natural variantiVAR_011323311D → N in EDAID; abolishes binding to polyubiquitin ('K63'-linked and linear) and greatly impairs tandem ubiquitin binding. 4 PublicationsCorresponds to variant dbSNP:rs179363867EnsemblClinVar.1
Natural variantiVAR_011324406D → V in EDAID. 1 PublicationCorresponds to variant dbSNP:rs137853327EnsemblClinVar.1
Natural variantiVAR_011325417C → F in EDAID. 2 PublicationsCorresponds to variant dbSNP:rs137853326EnsemblClinVar.1
Natural variantiVAR_011326417C → R in EDAID; loss of sumoylation. 6 PublicationsCorresponds to variant dbSNP:rs137853325EnsemblClinVar.1
Ectodermal dysplasia, anhidrotic, with immunodeficiency, osteopetrosis and lymphedema (OLEDAID)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of ectoderma dysplasia, a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. Characterized by the association of anhidrotic ectodermal dysplasia with severe immunodeficiency, osteopetrosis and lymphedema.
See also OMIM:300301
Immunodeficiency, NEMO-related, without anhidrotic ectodermal dysplasia (NEMOID)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionPatients manifest immunodeficiency not associated with other abnormalities, and resulting in increased susceptibility to infections. Patients suffer from multiple episodes of infectious diseases.
See also OMIM:300584
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_026496417C → Y in NEMOID. 1 PublicationCorresponds to variant dbSNP:rs137853326EnsemblClinVar.1
Immunodeficiency 33 (IMD33)3 Publications
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA X-linked recessive form of Mendelian susceptibility to mycobacterial disease, a rare condition characterized by predisposition to illness caused by moderately virulent mycobacterial species, such as Bacillus Calmette-Guerin (BCG) vaccine, environmental non-tuberculous mycobacteria, and by the more virulent Mycobacterium tuberculosis. Other microorganisms rarely cause severe clinical disease in individuals with susceptibility to mycobacterial infections, with the exception of Salmonella which infects less than 50% of these individuals.
See also OMIM:300636
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_031959315E → A in IMD33; greatly impairs tandem ubiquitin binding. Impairs oligomerization, impairs binding of 'Lys-63'-linked ubiuitin and linear tetra-ubiquitin, impairs TNF-induced NF-kappa-B activation. 3 PublicationsCorresponds to variant dbSNP:rs137853331EnsemblClinVar.1
Natural variantiVAR_031960319R → Q in IMD33; impairs tandem ubiquitin binding. 2 PublicationsCorresponds to variant dbSNP:rs137853332EnsemblClinVar.1
Recurrent isolated invasive pneumococcal disease 2 (IPD2)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionRecurrent invasive pneumococcal disease (IPD) is defined as two episodes of IPD occurring at least 1 month apart, whether caused by the same or different serotypes or strains. Recurrent IPD occurs in at least 2% of patients in most series, making IPD the most important known risk factor for subsequent IPD.
See also OMIM:300640
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_031958173R → G in IPD2. 1 PublicationCorresponds to variant dbSNP:rs179363866EnsemblClinVar.1
Incontinentia pigmenti (IP)7 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA genodermatosis usually prenatally lethal in males. In affected females, it causes abnormalities of the skin, hair, eyes, nails, teeth, skeleton, heart, and central nervous system. The prominent skin signs occur in four classic cutaneous stages: perinatal inflammatory vesicles, verrucous patches, a distinctive pattern of hyperpigmentation and dermal scarring.
See also OMIM:308300
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02649157E → K in IP; shows the same luciferase activity as the control. 2 PublicationsCorresponds to variant dbSNP:rs148695964EnsemblClinVar.1
Natural variantiVAR_02649290Missing in IP; only 46.3% of the activation obtained with the wild-type protein. 1 Publication1
Natural variantiVAR_026494123R → W in IP; shows the same luciferase activity as the control. 1 PublicationCorresponds to variant dbSNP:rs179363895EnsemblClinVar.1
Natural variantiVAR_072603170L → P in IP. 1 Publication1
Natural variantiVAR_072604173R → Q in IP. 1 Publication1
Natural variantiVAR_072605183Q → H in IP. 1 PublicationCorresponds to variant dbSNP:rs1198984417Ensembl.1
Natural variantiVAR_072606314A → P in IP. 1 Publication1
Natural variantiVAR_072607322L → P in IP. 1 Publication1
Natural variantiVAR_042666323A → P in IP; diminishes interaction with TRAF6 and polyubiquitination, greatly impairs tandem ubiquitin binding. Impairs oligomerization, greatly impairs binding of 'Lys-63'-linked ubiuitin and linear tetra-ubiquitin, impairs TNF-induced NF-kappa-B activation. 3 PublicationsCorresponds to variant dbSNP:rs179363865EnsemblClinVar.1
Natural variantiVAR_009182407M → V in IP; impairs binding to ubiquitin. 3 PublicationsCorresponds to variant dbSNP:rs137853322EnsemblClinVar.1
Natural variantiVAR_072608413H → Y in IP. 1 Publication1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi68S → A: Increases formation of homodimers. 1 Publication1
Mutagenesisi68S → E: Abolishes interaction with IKBKB; abolishes TNF-alpha induced NF-kappa-B activity. 1 Publication1
Mutagenesisi85S → A: Decreases ubiquitination and abolishes nuclear export. 1 Publication1
Mutagenesisi115K → R: No change in the ubiquitination level; when associated with R-399. 1 Publication1
Mutagenesisi224K → R: No change in the ubiquitination level; when associated with R-399. 1 Publication1
Mutagenesisi277K → A: Partial abolition of sumoylation. Abolishes sumoylation and IKK activation; when associated with A-309. 1 Publication1
Mutagenesisi285K → R: Important decrease in the ubiquitination level; when associated with R-399. 1 Publication1
Mutagenesisi296E → A: No effet on oligomerization,impairs binding of 'Lys-63'-linked ubiuitin and linear tetra-ubiquitin, impairs TNF-induced NF-kappa-B activation. 1 Publication1
Mutagenesisi300V → D: Greatly impairs tandem ubiquitin binding. 1 Publication1
Mutagenesisi301L → A: Impairs tandem ubiquitin binding. 1 Publication1
Mutagenesisi304Q → A: Complete loss of cleavage by HAV protease 3c. 1 Publication1
Mutagenesisi304Q → A: Impairs tandem ubiquitin binding. 1 Publication1
Mutagenesisi307I → N: Greatly impairs tandem ubiquitin binding. 1 Publication1
Mutagenesisi308Y → A: Greatly impairs tandem ubiquitin binding. 1 Publication1
Mutagenesisi309K → A: Partial abolition of sumoylation. Abolishes sumoylation and IKK activation; when associated with A-277. 1 Publication1
Mutagenesisi312F → A: Greatly impairs tandem ubiquitin binding,impairs oligomerization, impairs TNF-induced NF-kappa-B activation. 2 Publications1
Mutagenesisi312F → W: MNo effet on oligomerization, preferentially binds tri-ubiquitin chains ('Lys-48' or 'Lys-63'-linked). 2 Publications1
Mutagenesisi312F → Y: Impairs tandem ubiquitin binding. 2 Publications1
Mutagenesisi313Q → A: Impairs tandem ubiquitin binding. 1 Publication1
Mutagenesisi315E → Q: Greatly impairs tandem ubiquitin binding. 1 Publication1
Mutagenesisi317Q → A or W: Greatly impairs tandem ubiquitin binding. 1 Publication1
Mutagenesisi323A → D: Greatly impairs tandem ubiquitin binding. 1 Publication1
Mutagenesisi329L → A: Impairs oligomerization, impairs binding of 'Lys-63'-linked ubiuitin, impairs TNF-induced NF-kappa-B activation; when associated with A-336. 2 Publications1
Mutagenesisi329L → P: Abolishes binding to polyubiquitin. 2 Publications1
Mutagenesisi336L → A: Impairs oligomerization, impairs binding of 'Lys-63'-linked ubiuitin, impairs TNF-induced NF-kappa-B activation; when associated with A-329. 1 Publication1
Mutagenesisi399K → R: Abolishes BCL10-mediated but not RIPK2-mediated ubiquitination. Important decrease in the ubiquitination level; when associated with R-285. No change in the ubiquitination level; when associated with R-115 or R-224. 2 Publications1
Mutagenesisi414V → S: Abolishes binding to polyubiquitin. 1 Publication1
Mutagenesisi415M → S: Impairs binding to polyubiquitin. 1 Publication1

Keywords - Diseasei

Disease mutation, Ectodermal dysplasia, Osteopetrosis

Organism-specific databases

DisGeNET

More...DisGeNETi		8517

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...GeneReviewsi		IKBKG

MalaCards human disease database

More...MalaCardsi		IKBKG
MIMi300291 phenotype
300301 phenotype
300584 phenotype
300636 phenotype
300640 phenotype
308300 phenotype

Open Targets

More...OpenTargetsi		ENSG00000269335

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		69088 Anhidrotic ectodermal dysplasia-immunodeficiency-osteopetrosis-lymphedema syndrome
98813 Hypohidrotic ectodermal dysplasia with immunodeficiency
464 Incontinentia pigmenti
319612 X-linked mendelian susceptibility to mycobacterial diseases due to IKBKG deficiency

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA29777

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL4967

Drug and drug target database

More...DrugBanki		DB04998 AGRO100
DB05289 MPC-7869

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		IKBKG

Domain mapping of disease mutations (DMDM)

More...DMDMi		6685695

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000967821 – 419NF-kappa-B essential modulatorAdd BLAST419

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei31Phosphoserine; by IKKB1 Publication1
Modified residuei43Phosphoserine; by IKKB1 Publication1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi54Interchain1 Publication
Modified residuei68Phosphoserine1 Publication1
Modified residuei85Phosphoserine; by ATM1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki111Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki139Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki143Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki226Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki246Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki264Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki277Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternate1 Publication
Cross-linki277Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate2 Publications
Cross-linki283Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki285Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)3 Publications
Cross-linki292Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki302Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki309Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternate1 Publication
Cross-linki309Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate4 Publications
Cross-linki321Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki325Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)By similarity
Cross-linki326Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Disulfide bondi347Interchain1 Publication
Modified residuei376Phosphoserine; by IKKB1 Publication1
Modified residuei387PhosphoserineCombined sources1 Publication1
Cross-linki399Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation at Ser-68 attenuates aminoterminal homodimerization.1 Publication
Polyubiquitinated on Lys-285 through 'Lys-63'; the ubiquitination is mediated by NOD2 and RIPK2 and probably plays a role in signaling by facilitating interactions with ubiquitin domain-containing proteins and activates the NF-kappa-B pathway. Polyubiquitinated on Lys-399 through 'Lys-63'; the ubiquitination is mediated by BCL10, MALT1 and TRAF6 and probably plays a role in signaling by facilitating interactions with ubiquitin domain-containing proteins and activates the NF-kappa-B pathway. Monoubiquitinated on Lys-277 and Lys-309; promotes nuclear export. Polyubiquitinated through 'Lys-27' by TRIM23; involved in antiviral innate and inflammatory responses. Linear polyubiquitinated on Lys-111, Lys-143, Lys-226, Lys-246, Lys-264, Lys-277, Lys-285, Lys-292, Lys-302, Lys-309 and Lys-326; the head-to-tail polyubiquitination is mediated by the LUBAC complex and plays a key role in NF-kappa-B activation. Deubiquitinated by USP10 in a TANK-dependent and -independent manner, leading to the negative regulation of NF-kappa-B signaling upon DNA damage (PubMed:25861989).7 Publications
Sumoylated on Lys-277 and Lys-309 with SUMO1; the modification results in phosphorylation of Ser-85 by ATM leading to a replacement of the sumoylation by mono-ubiquitination on these residues.5 Publications
Neddylated by TRIM40, resulting in stabilization of NFKBIA and down-regulation of NF-kappa-B activity.1 Publication
(Microbial infection) Cleaved by hepatitis A virus (HAV) protease 3C allowing the virus to disrupt the host innate immune signaling.1 Publication
(Microbial infection) Polyubiquitinated on Lys-309 and Lys-321 via 'Lys-27'-linked ubiquitin by Shigella flexneri E3 ubiquitin-protein ligase ipah9.8, leading to its degradation by the proteasome.1 Publication

Keywords - PTMi

Disulfide bond, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9Y6K9

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9Y6K9

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9Y6K9

PeptideAtlas

More...PeptideAtlasi		Q9Y6K9

PRoteomics IDEntifications database

More...PRIDEi		Q9Y6K9

ProteomicsDB human proteome resource

More...ProteomicsDBi		86716
86717 [Q9Y6K9-2]
86718 [Q9Y6K9-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9Y6K9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9Y6K9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000269335 Expressed in 90 organ(s), highest expression level in blood

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9Y6K9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9Y6K9 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB010373
HPA000426

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer; disulfide-linked. Component of the I-kappa-B-kinase (IKK) core complex consisting of CHUK, IKBKB and IKBKG; probably four alpha/CHUK-beta/IKBKB dimers are associated with four gamma/IKBKG subunits. The IKK core complex seems to associate with regulatory or adapter proteins to form a IKK-signalosome holo-complex. The IKK complex associates with TERF2IP/RAP1, leading to promote IKK-mediated phosphorylation of RELA/p65. Part of a complex composed of NCOA2, NCOA3, CHUK/IKKA, IKBKB, IKBKG and CREBBP. Interacts with COPS3, CYLD, NALP2, TRPC4AP and PIDD1. Interacts with ATM; the complex is exported from the nucleus. Interacts with TRAF6. Interacts with IKBKE. Interacts with TANK; the interaction is enhanced by IKBKE and TBK1. Part of a ternary complex consisting of TANK, IKBKB and IKBKG. Interacts with ZFAND5. Interacts with RIPK2. Interacts with TNIP1 and TNFAIP3; TNIP1 facilitates the TNFAIP3-mediated de-ubiquitination of IKBKG. Interacts with TNFAIP3; the interaction is induced by TNF stimulation and by polyubiquitin. Binds polyubiquitin; the interaction is mediated by two domains; reports about the binding to 'Lys-63'-linked and/or linear polyubiquitin, respective binding affinities and stoichiometry are conflicting. Interacts with NLRP10. Interacts with TANK; this interaction increases in response to DNA damage (PubMed:25861989). Interacts with USP10; this interaction increases in response to DNA damage (PubMed:25861989). Interacts with ZC3H12A; this interaction increases in response to DNA damage (PubMed:25861989). Interacts with IFIT5; the interaction synergizes the recruitment of IKK to MAP3K7 and enhances IKK phosphorylation (PubMed:26334375). Interacts with TRIM29; this interaction induces IKBKG/NEMO ubiquitination and proteolytic degradation (PubMed:27695001). Interacts with TRIM13; this interaction leads to IKBKG/NEMO ubiquitination (PubMed:25152375).21 Publications
(Microbial infection) Interacts with Molluscum contagiosum virus protein MC005; this interaction inhibits NF-kappa-B activation.1 Publication
(Microbial infection) Interacts with HTLV-1 Tax oncoprotein; the interaction activates IKBKG.2 Publications
(Microbial infection) Interacts with Shigella flexneri ipah9.8; the interaction promotes TNIP1-dependent 'Lys-27'-linked polyubiquitination of IKBKG which perturbs NF-kappa-B activation during bacterial infection.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		114089, 339 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-3269 IkappaB kinase complex

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q9Y6K9

Database of interacting proteins

More...DIPi		DIP-27528N

Protein interaction database and analysis system

More...IntActi		Q9Y6K9, 229 interactors

Molecular INTeraction database

More...MINTi		Q9Y6K9

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000483825

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q9Y6K9

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1419
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2JVXNMR-A394-419[»]
2JVYNMR-A394-419[»]
3BRTX-ray2.25B/D44-111[»]
3BRVX-ray2.20B/D44-111[»]
3CL3X-ray3.20D/E150-272[»]
3FX0X-ray3.20A/B246-337[»]
4BWNX-ray2.27A/B258-344[»]
5AAYNMR-A392-419[»]
5LDEX-ray3.38R/S230-249[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		Q9Y6K9

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9Y6K9

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q9Y6K9

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni44 – 111Interaction with CHUK/IKBKBAdd BLAST68
Regioni150 – 257Interaction with TANKAdd BLAST108
Regioni242 – 350Ubiquitin-binding (UBD)Add BLAST109
Regioni246 – 365Self-associationAdd BLAST120
Regioni251 – 419Required for interaction with TNFAIP3Add BLAST169
Regioni322 – 343Leucine-zipperSequence analysisAdd BLAST22
Regioni382 – 419Interaction with CYLD1 PublicationAdd BLAST38

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili49 – 356Sequence analysisAdd BLAST308

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The leucine-zipper domain and the CCHC NOA-type zinc-finger are essential for polyubiquitin binding and for the activation of IRF3.2 Publications

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri389 – 419CCHC NOA-typePROSITE-ProRule annotationAdd BLAST31

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410IJBJ Eukaryota
ENOG410Y1FG LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00530000063808

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000293233

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG000417

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9Y6K9

KEGG Orthology (KO)

More...KOi		K07210

Identification of Orthologs from Complete Genome Data

More...OMAi		EFLMQKF

Database of Orthologous Groups

More...OrthoDBi		745047at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9Y6K9

TreeFam database of animal gene trees

More...TreeFami		TF326608

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR032419 CC2-LZ_dom
IPR021063 NEMO_N
IPR034735 NEMO_ZF

Pfam protein domain database

More...Pfami		View protein in Pfam
PF16516 CC2-LZ, 1 hit
PF11577 NEMO, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51801 ZF_CCHC_NOA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y6K9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNRHLWKSQL CEMVQPSGGP AADQDVLGEE SPLGKPAMLH LPSEQGAPET 
        60         70         80         90        100
LQRCLEENQE LRDAIRQSNQ ILRERCEELL HFQASQREEK EFLMCKFQEA 
       110        120        130        140        150
RKLVERLGLE KLDLKRQKEQ ALREVEHLKR CQQQMAEDKA SVKAQVTSLL 
       160        170        180        190        200
GELQESQSRL EAATKECQAL EGRARAASEQ ARQLESEREA LQQQHSVQVD 
       210        220        230        240        250
QLRMQGQSVE AALRMERQAA SEEKRKLAQL QVAYHQLFQE YDNHIKSSVV 
       260        270        280        290        300
GSERKRGMQL EDLKQQLQQA EEALVAKQEV IDKLKEEAEQ HKIVMETVPV 
       310        320        330        340        350
LKAQADIYKA DFQAERQARE KLAEKKELLQ EQLEQLQREY SKLKASCQES 
       360        370        380        390        400
ARIEDMRKRH VEVSQAPLPP APAYLSSPLA LPSQRRSPPE EPPDFCCPKC 
       410 
QYQAPDMDTL QIHVMECIE
Length:419
Mass (Da):48,198
Last modified:May 30, 2000 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i322D1037881447FF
GO
Isoform 2 (identifier: Q9Y6K9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MALVIQVGKLRPREVRTPQTINPSLFPSLPVKLSSIIEVPSGGERCCSRRTLVYKARAFWKGAPLPCWM

Show »
Length:487
Mass (Da):55,787
Checksum:i7A39E991E0013A73
GO
Isoform 3 (identifier: Q9Y6K9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     174-224: Missing.
     257-304: Missing.

Show »
Length:320
Mass (Da):36,953
Checksum:i3BEF2487C4446725
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087X1B1A0A087X1B1_HUMAN
NF-kappa-B essential modulator
IKBKG
418Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X0G7A0A087X0G7_HUMAN
NF-kappa-B essential modulator
IKBKG
411Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WUW6A0A087WUW6_HUMAN
NF-kappa-B essential modulator
IKBKG
412Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J2V2C9J2V2_HUMAN
NF-kappa-B essential modulator
IKBKG
195Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JCG6C9JCG6_HUMAN
NF-kappa-B essential modulator
IKBKG
138Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JH59C9JH59_HUMAN
NF-kappa-B essential modulator
IKBKG
172Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JN51C9JN51_HUMAN
NF-kappa-B essential modulator
IKBKG
250Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X1K7A0A087X1K7_HUMAN
NF-kappa-B essential modulator
IKBKG
181Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WV30A0A087WV30_HUMAN
NF-kappa-B essential modulator
IKBKG
115Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WWQ9A0A087WWQ9_HUMAN
NF-kappa-B essential modulator
IKBKG
48Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti341S → R in AAD12183 (PubMed:9927690).Curated1
Sequence conflicti387S → R in AAD12183 (PubMed:9927690).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02649157E → K in IP; shows the same luciferase activity as the control. 2 PublicationsCorresponds to variant dbSNP:rs148695964EnsemblClinVar.1
Natural variantiVAR_02649290Missing in IP; only 46.3% of the activation obtained with the wild-type protein. 1 Publication1
Natural variantiVAR_026493113D → N1 PublicationCorresponds to variant dbSNP:rs179363896EnsemblClinVar.1
Natural variantiVAR_026494123R → W in IP; shows the same luciferase activity as the control. 1 PublicationCorresponds to variant dbSNP:rs179363895EnsemblClinVar.1
Natural variantiVAR_026495153L → R in EDAID. 2 PublicationsCorresponds to variant dbSNP:rs137853328EnsemblClinVar.1
Natural variantiVAR_072603170L → P in IP. 1 Publication1
Natural variantiVAR_031958173R → G in IPD2. 1 PublicationCorresponds to variant dbSNP:rs179363866EnsemblClinVar.1
Natural variantiVAR_072604173R → Q in IP. 1 Publication1
Natural variantiVAR_011320175R → P in EDAID. 1 PublicationCorresponds to variant dbSNP:rs179363868EnsemblClinVar.1
Natural variantiVAR_072605183Q → H in IP. 1 PublicationCorresponds to variant dbSNP:rs1198984417Ensembl.1
Natural variantiVAR_011321227L → P in EDAID. 1 PublicationCorresponds to variant dbSNP:rs179363869EnsemblClinVar.1
Natural variantiVAR_011322288A → G in EDAID. 1 PublicationCorresponds to variant dbSNP:rs137853330EnsemblClinVar.1
Natural variantiVAR_011323311D → N in EDAID; abolishes binding to polyubiquitin ('K63'-linked and linear) and greatly impairs tandem ubiquitin binding. 4 PublicationsCorresponds to variant dbSNP:rs179363867EnsemblClinVar.1
Natural variantiVAR_072606314A → P in IP. 1 Publication1
Natural variantiVAR_031959315E → A in IMD33; greatly impairs tandem ubiquitin binding. Impairs oligomerization, impairs binding of 'Lys-63'-linked ubiuitin and linear tetra-ubiquitin, impairs TNF-induced NF-kappa-B activation. 3 PublicationsCorresponds to variant dbSNP:rs137853331EnsemblClinVar.1
Natural variantiVAR_031960319R → Q in IMD33; impairs tandem ubiquitin binding. 2 PublicationsCorresponds to variant dbSNP:rs137853332EnsemblClinVar.1
Natural variantiVAR_072607322L → P in IP. 1 Publication1
Natural variantiVAR_042666323A → P in IP; diminishes interaction with TRAF6 and polyubiquitination, greatly impairs tandem ubiquitin binding. Impairs oligomerization, greatly impairs binding of 'Lys-63'-linked ubiuitin and linear tetra-ubiquitin, impairs TNF-induced NF-kappa-B activation. 3 PublicationsCorresponds to variant dbSNP:rs179363865EnsemblClinVar.1
Natural variantiVAR_011324406D → V in EDAID. 1 PublicationCorresponds to variant dbSNP:rs137853327EnsemblClinVar.1
Natural variantiVAR_009182407M → V in IP; impairs binding to ubiquitin. 3 PublicationsCorresponds to variant dbSNP:rs137853322EnsemblClinVar.1
Natural variantiVAR_072608413H → Y in IP. 1 Publication1
Natural variantiVAR_011325417C → F in EDAID. 2 PublicationsCorresponds to variant dbSNP:rs137853326EnsemblClinVar.1
Natural variantiVAR_011326417C → R in EDAID; loss of sumoylation. 6 PublicationsCorresponds to variant dbSNP:rs137853325EnsemblClinVar.1
Natural variantiVAR_026496417C → Y in NEMOID. 1 PublicationCorresponds to variant dbSNP:rs137853326EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0410001M → MALVIQVGKLRPREVRTPQT INPSLFPSLPVKLSSIIEVP SGGERCCSRRTLVYKARAFW KGAPLPCWM in isoform 2. 1 Publication1
Alternative sequenceiVSP_041001174 – 224Missing in isoform 3. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_041002257 – 304Missing in isoform 3. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF062089 mRNA Translation: AAD12183.1
AF091453 mRNA Translation: AAD38081.1
AF074382 mRNA Translation: AAC36330.1
AJ271718 Genomic DNA Translation: CAB93146.1
AF261086 mRNA Translation: AAF99679.1
AY114157 mRNA Translation: AAM44073.1
AK000593 mRNA No translation available.
BT019621 mRNA Translation: AAV38427.1
AF277315 Genomic DNA Translation: AAL27012.1
BC000299 mRNA Translation: AAH00299.1
BC012114 mRNA Translation: AAH12114.1
BC046922 mRNA Translation: AAH46922.1
BC050612 mRNA Translation: AAH50612.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS14757.1 [Q9Y6K9-1]
CCDS48196.1 [Q9Y6K9-2]
CCDS48197.1 [Q9Y6K9-3]

NCBI Reference Sequences

More...RefSeqi		NP_001093326.2, NM_001099856.4 [Q9Y6K9-2]
NP_001093327.1, NM_001099857.2 [Q9Y6K9-1]
NP_001138727.1, NM_001145255.2 [Q9Y6K9-3]
NP_001308325.1, NM_001321396.1 [Q9Y6K9-1]
NP_001308326.1, NM_001321397.1
NP_003630.1, NM_003639.4 [Q9Y6K9-1]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.43505

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000594239; ENSP00000471166; ENSG00000269335 [Q9Y6K9-1]
ENST00000611071; ENSP00000479662; ENSG00000269335 [Q9Y6K9-1]
ENST00000611176; ENSP00000478616; ENSG00000269335 [Q9Y6K9-3]
ENST00000618670; ENSP00000483825; ENSG00000269335 [Q9Y6K9-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		8517

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:8517

UCSC genome browser

More...UCSCi		uc033fbu.1 human [Q9Y6K9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

IKBKGbase

IKBKG mutation db

Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG)

Leiden Open Variation Database (LOVD)

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF062089 mRNA Translation: AAD12183.1
AF091453 mRNA Translation: AAD38081.1
AF074382 mRNA Translation: AAC36330.1
AJ271718 Genomic DNA Translation: CAB93146.1
AF261086 mRNA Translation: AAF99679.1
AY114157 mRNA Translation: AAM44073.1
AK000593 mRNA No translation available.
BT019621 mRNA Translation: AAV38427.1
AF277315 Genomic DNA Translation: AAL27012.1
BC000299 mRNA Translation: AAH00299.1
BC012114 mRNA Translation: AAH12114.1
BC046922 mRNA Translation: AAH46922.1
BC050612 mRNA Translation: AAH50612.1
CCDSiCCDS14757.1 [Q9Y6K9-1]
CCDS48196.1 [Q9Y6K9-2]
CCDS48197.1 [Q9Y6K9-3]
RefSeqiNP_001093326.2, NM_001099856.4 [Q9Y6K9-2]
NP_001093327.1, NM_001099857.2 [Q9Y6K9-1]
NP_001138727.1, NM_001145255.2 [Q9Y6K9-3]
NP_001308325.1, NM_001321396.1 [Q9Y6K9-1]
NP_001308326.1, NM_001321397.1
NP_003630.1, NM_003639.4 [Q9Y6K9-1]
UniGeneiHs.43505

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2JVXNMR-A394-419[»]
2JVYNMR-A394-419[»]
3BRTX-ray2.25B/D44-111[»]
3BRVX-ray2.20B/D44-111[»]
3CL3X-ray3.20D/E150-272[»]
3FX0X-ray3.20A/B246-337[»]
4BWNX-ray2.27A/B258-344[»]
5AAYNMR-A392-419[»]
5LDEX-ray3.38R/S230-249[»]
ProteinModelPortaliQ9Y6K9
SMRiQ9Y6K9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114089, 339 interactors
ComplexPortaliCPX-3269 IkappaB kinase complex
CORUMiQ9Y6K9
DIPiDIP-27528N
IntActiQ9Y6K9, 229 interactors
MINTiQ9Y6K9
STRINGi9606.ENSP00000483825

Chemistry databases

BindingDBiQ9Y6K9
ChEMBLiCHEMBL4967
DrugBankiDB04998 AGRO100
DB05289 MPC-7869

Protein family/group databases

MoonDBiQ9Y6K9 Predicted

PTM databases

iPTMnetiQ9Y6K9
PhosphoSitePlusiQ9Y6K9

Polymorphism and mutation databases

BioMutaiIKBKG
DMDMi6685695

Proteomic databases

EPDiQ9Y6K9
jPOSTiQ9Y6K9
PaxDbiQ9Y6K9
PeptideAtlasiQ9Y6K9
PRIDEiQ9Y6K9
ProteomicsDBi86716
86717 [Q9Y6K9-2]
86718 [Q9Y6K9-3]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		8517
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000594239; ENSP00000471166; ENSG00000269335 [Q9Y6K9-1]
ENST00000611071; ENSP00000479662; ENSG00000269335 [Q9Y6K9-1]
ENST00000611176; ENSP00000478616; ENSG00000269335 [Q9Y6K9-3]
ENST00000618670; ENSP00000483825; ENSG00000269335 [Q9Y6K9-2]
GeneIDi8517
KEGGihsa:8517
UCSCiuc033fbu.1 human [Q9Y6K9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		8517
DisGeNETi8517
EuPathDBiHostDB:ENSG00000269335.5

GeneCards: human genes, protein and diseases

More...GeneCardsi		IKBKG
GeneReviewsiIKBKG

H-Invitational Database, human transcriptome db

More...H-InvDBi		HIX0203333
HGNCiHGNC:5961 IKBKG
HPAiCAB010373
HPA000426
MalaCardsiIKBKG
MIMi300248 gene
300291 phenotype
300301 phenotype
300584 phenotype
300636 phenotype
300640 phenotype
308300 phenotype
neXtProtiNX_Q9Y6K9
OpenTargetsiENSG00000269335
Orphaneti69088 Anhidrotic ectodermal dysplasia-immunodeficiency-osteopetrosis-lymphedema syndrome
98813 Hypohidrotic ectodermal dysplasia with immunodeficiency
464 Incontinentia pigmenti
319612 X-linked mendelian susceptibility to mycobacterial diseases due to IKBKG deficiency
PharmGKBiPA29777

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410IJBJ Eukaryota
ENOG410Y1FG LUCA
GeneTreeiENSGT00530000063808
HOGENOMiHOG000293233
HOVERGENiHBG000417
InParanoidiQ9Y6K9
KOiK07210
OMAiEFLMQKF
OrthoDBi745047at2759
PhylomeDBiQ9Y6K9
TreeFamiTF326608

Enzyme and pathway databases

ReactomeiR-HSA-1169091 Activation of NF-kappaB in B cells
R-HSA-1236974 ER-Phagosome pathway
R-HSA-168638 NOD1/2 Signaling Pathway
R-HSA-168927 TICAM1, RIP1-mediated IKK complex recruitment
R-HSA-1810476 RIP-mediated NFkB activation via ZBP1
R-HSA-202424 Downstream TCR signaling
R-HSA-2871837 FCERI mediated NF-kB activation
R-HSA-445989 TAK1 activates NFkB by phosphorylation and activation of IKKs complex
R-HSA-450302 activated TAK1 mediates p38 MAPK activation
R-HSA-450321 JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1
R-HSA-4755510 SUMOylation of immune response proteins
R-HSA-5357905 Regulation of TNFR1 signaling
R-HSA-5357956 TNFR1-induced NFkappaB signaling pathway
R-HSA-5602636 IKBKB deficiency causes SCID
R-HSA-5603027 IKBKG deficiency causes anhidrotic ectodermal dysplasia with immunodeficiency (EDA-ID) (via TLR)
R-HSA-5603029 IkBA variant leads to EDA-ID
R-HSA-5607764 CLEC7A (Dectin-1) signaling
R-HSA-5684264 MAP3K8 (TPL2)-dependent MAPK1/3 activation
R-HSA-5689880 Ub-specific processing proteases
R-HSA-5689896 Ovarian tumor domain proteases
R-HSA-9020702 Interleukin-1 signaling
R-HSA-933542 TRAF6 mediated NF-kB activation
R-HSA-933543 NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10
R-HSA-937039 IRAK1 recruits IKK complex
R-HSA-937041 IKK complex recruitment mediated by RIP1
R-HSA-975144 IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation
SABIO-RKiQ9Y6K9
SIGNORiQ9Y6K9

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		IKBKG human
EvolutionaryTraceiQ9Y6K9

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		IKBKG

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		8517

Protein Ontology

More...PROi		PR:Q9Y6K9

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000269335 Expressed in 90 organ(s), highest expression level in blood
ExpressionAtlasiQ9Y6K9 baseline and differential
GenevisibleiQ9Y6K9 HS

Family and domain databases

InterProiView protein in InterPro
IPR032419 CC2-LZ_dom
IPR021063 NEMO_N
IPR034735 NEMO_ZF
PfamiView protein in Pfam
PF16516 CC2-LZ, 1 hit
PF11577 NEMO, 1 hit
PROSITEiView protein in PROSITE
PS51801 ZF_CCHC_NOA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNEMO_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y6K9
Secondary accession number(s): Q7LBY6, Q7Z7F1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 30, 2000
Last modified: April 10, 2019
This is version 213 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again