Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine/tyrosine-interacting-like protein 1

Gene

STYXL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalytically inactive phosphatase (PubMed:20180778, PubMed:23163895). By binding to G3BP1, inhibits the formation of G3BP1-induced stress granules (PubMed:20180778, PubMed:23163895). Does not act by protecting the dephosphorylation of G3BP1 at 'Ser-149' (PubMed:23163895). Inhibits PTPMT1 phosphatase activity (PubMed:24709986). By inhibiting PTPMT1, positively regulates intrinsic apoptosis (PubMed:21262771). May play a role in the formation of neurites during neuronal development (PubMed:29250526).5 Publications

Caution

Lacks the two active site residues His and Cys at position 245 and 246 which are essential for dual-specificity phosphatase activity. Lacks phosphatase activity.2 Publications

GO - Molecular functioni

  • protein phosphatase binding Source: UniProtKB
  • protein phosphatase inhibitor activity Source: UniProtKB
  • protein tyrosine/serine/threonine phosphatase activity Source: InterPro
  • pseudophosphatase activity Source: UniProtKB

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine/tyrosine-interacting-like protein 1
Alternative name(s):
Dual specificity phosphatase inhibitor MK-STYX
Dual specificity protein phosphatase 24
Inactive dual specificity protein phosphatase MK-STYXCurated
Map kinase phosphatase-like protein MK-STYX
Gene namesi
Name:STYXL1
Synonyms:DUSP24, MKSTYX
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000127952.16
HGNCiHGNC:18165 STYXL1
neXtProtiNX_Q9Y6J8

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi245 – 246FS → HC: Confers phosphatase activity. Dephosphorylates G3BP1 at 'Ser-149'. Loss of interaction with G3BP1. Reduces arsenite-induced stress granule formation. 2 Publications2

Organism-specific databases

DisGeNETi51657
OpenTargetsiENSG00000127952
PharmGKBiPA134942462

Polymorphism and mutation databases

BioMutaiSTYXL1
DMDMi29840801

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000948371 – 313Serine/threonine/tyrosine-interacting-like protein 1Add BLAST313

Proteomic databases

PaxDbiQ9Y6J8
PeptideAtlasiQ9Y6J8
PRIDEiQ9Y6J8
ProteomicsDBi86702
86703 [Q9Y6J8-2]
86704 [Q9Y6J8-3]
86705 [Q9Y6J8-4]
86706 [Q9Y6J8-5]

PTM databases

DEPODiQ9Y6J8
iPTMnetiQ9Y6J8
PhosphoSitePlusiQ9Y6J8

Expressioni

Gene expression databases

BgeeiENSG00000127952 Expressed in 208 organ(s), highest expression level in right uterine tube
CleanExiHS_STYXL1
ExpressionAtlasiQ9Y6J8 baseline and differential
GenevisibleiQ9Y6J8 HS

Organism-specific databases

HPAiHPA050261

Interactioni

Subunit structurei

Interacts with G3BP1 (PubMed:20180778). Interacts with PTPMT1; the interaction inhibits PTPMT1 catalytic activity (PubMed:24709986).2 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi119663, 13 interactors
STRINGi9606.ENSP00000248600

Structurei

3D structure databases

ProteinModelPortaliQ9Y6J8
SMRiQ9Y6J8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini27 – 138RhodanesePROSITE-ProRule annotationAdd BLAST112
Domaini160 – 301Tyrosine-protein phosphataseSequence analysisAdd BLAST142

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1716 Eukaryota
COG2453 LUCA
GeneTreeiENSGT00390000010113
HOGENOMiHOG000004828
HOVERGENiHBG052516
InParanoidiQ9Y6J8
KOiK18047
OMAiRPNRGFV
OrthoDBiEOG091G0JOE
PhylomeDBiQ9Y6J8
TreeFamiTF352452

Family and domain databases

Gene3Di3.40.250.10, 1 hit
3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR000340 Dual-sp_phosphatase_cat-dom
IPR024950 DUSP
IPR029021 Prot-tyrosine_phosphatase-like
IPR001763 Rhodanese-like_dom
IPR036873 Rhodanese-like_dom_sf
IPR020422 TYR_PHOSPHATASE_DUAL_dom
PANTHERiPTHR10159 PTHR10159, 1 hit
PfamiView protein in Pfam
PF00782 DSPc, 1 hit
PF00581 Rhodanese, 1 hit
SMARTiView protein in SMART
SM00195 DSPc, 1 hit
SM00450 RHOD, 1 hit
SUPFAMiSSF52799 SSF52799, 1 hit
SSF52821 SSF52821, 1 hit
PROSITEiView protein in PROSITE
PS50054 TYR_PHOSPHATASE_DUAL, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Experimental confirmation may be lacking for some isoforms.

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y6J8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPGLLLCEPT ELYNILNQAT KLSRLTDPNY LCLLDVRSKW EYDESHVITA
60 70 80 90 100
LRVKKKNNEY LLPESVDLEC VKYCVVYDNN SSTLEILLKD DDDDSDSDGD
110 120 130 140 150
GKDLVPQAAI EYGRILTRLT HHPVYILKGG YERFSGTYHF LRTQKIIWMP
160 170 180 190 200
QELDAFQPYP IEIVPGKVFV GNFSQACDPK IQKDLKIKAH VNVSMDTGPF
210 220 230 240 250
FAGDADKLLH IRIEDSPEAQ ILPFLRHMCH FIEIHHHLGS VILIFSTQGI
260 270 280 290 300
SRSCAAIIAY LMHSNEQTLQ RSWAYVKKCK NNMCPNRGLV SQLLEWEKTI
310
LGDSITNIMD PLY
Length:313
Mass (Da):35,818
Last modified:November 1, 1999 - v1
Checksum:i5EDB25AB4EB60419
GO
Isoform 2 (identifier: Q9Y6J8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     233-287: EIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPNR → GYQPQLCRHHSLPHA
     288-313: Missing.

Show »
Length:247
Mass (Da):28,330
Checksum:iBE7BE323BED2552D
GO
Isoform 3 (identifier: Q9Y6J8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     234-313: IHHHLGSVIL...SITNIMDPLY → VLGLCQEVQK...RRRPLLPESL

Show »
Length:318
Mass (Da):36,110
Checksum:i1C1DEC7DF8E9B493
GO
Isoform 4 (identifier: Q9Y6J8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     56-151: Missing.

Show »
Length:217
Mass (Da):24,752
Checksum:iDC1D778045C40929
GO
Isoform 5 (identifier: Q9Y6J8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     103-138: DLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTY → GTGCISAIP
     139-313: Missing.

Show »
Length:111
Mass (Da):12,475
Checksum:i42E0DCD053A70068
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J4H0C9J4H0_HUMAN
Serine/threonine/tyrosine-interacti...
STYXL1
282Annotation score:
A0A0C4DG63A0A0C4DG63_HUMAN
Serine/threonine/tyrosine-interacti...
STYXL1
221Annotation score:
H0Y6C4H0Y6C4_HUMAN
Serine/threonine/tyrosine-interacti...
STYXL1
68Annotation score:
H7C1Y2H7C1Y2_HUMAN
Serine/threonine/tyrosine-interacti...
STYXL1
68Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00517556 – 151Missing in isoform 4. CuratedAdd BLAST96
Alternative sequenceiVSP_005176103 – 138DLVPQ…FSGTY → GTGCISAIP in isoform 5. CuratedAdd BLAST36
Alternative sequenceiVSP_005177139 – 313Missing in isoform 5. CuratedAdd BLAST175
Alternative sequenceiVSP_005178233 – 287EIHHH…MCPNR → GYQPQLCRHHSLPHA in isoform 2. CuratedAdd BLAST55
Alternative sequenceiVSP_005180234 – 313IHHHL…MDPLY → VLGLCQEVQKQHVSKSGIGE PAAGMGEDYPWRFHHKHHGS ALLIFSEAHRRVLKSLTWGH FVGGGPECVYPGLSGRRRPL LPESL in isoform 3. CuratedAdd BLAST80
Alternative sequenceiVSP_005179288 – 313Missing in isoform 2. CuratedAdd BLAST26

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF069762 mRNA Translation: AAD36983.1
AC006330 Genomic DNA Translation: AAS07535.1
BC024035 mRNA Translation: AAH24035.1
AF188201 mRNA Translation: AAF04111.1
AF188202 mRNA Translation: AAF04112.1
AF188203 mRNA Translation: AAF04113.1
AF188204 mRNA Translation: AAF04114.1
AF169647 mRNA Translation: AAD53723.1
AF169648 mRNA Translation: AAD53724.1
CCDSiCCDS5580.1 [Q9Y6J8-1]
CCDS83193.1 [Q9Y6J8-4]
RefSeqiNP_001304714.1, NM_001317785.1 [Q9Y6J8-1]
NP_001304715.1, NM_001317786.1 [Q9Y6J8-1]
NP_001304716.1, NM_001317787.1 [Q9Y6J8-4]
NP_001304717.1, NM_001317788.1
NP_001304718.1, NM_001317789.1
NP_057170.1, NM_016086.2 [Q9Y6J8-1]
XP_011514595.1, XM_011516293.2 [Q9Y6J8-1]
UniGeneiHs.11615

Genome annotation databases

EnsembliENST00000248600; ENSP00000248600; ENSG00000127952 [Q9Y6J8-1]
ENST00000340062; ENSP00000343383; ENSG00000127952 [Q9Y6J8-4]
ENST00000359697; ENSP00000352726; ENSG00000127952 [Q9Y6J8-1]
ENST00000360591; ENSP00000353798; ENSG00000127952 [Q9Y6J8-4]
ENST00000431581; ENSP00000392221; ENSG00000127952 [Q9Y6J8-1]
GeneIDi51657
KEGGihsa:51657
UCSCiuc003uek.5 human [Q9Y6J8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF069762 mRNA Translation: AAD36983.1
AC006330 Genomic DNA Translation: AAS07535.1
BC024035 mRNA Translation: AAH24035.1
AF188201 mRNA Translation: AAF04111.1
AF188202 mRNA Translation: AAF04112.1
AF188203 mRNA Translation: AAF04113.1
AF188204 mRNA Translation: AAF04114.1
AF169647 mRNA Translation: AAD53723.1
AF169648 mRNA Translation: AAD53724.1
CCDSiCCDS5580.1 [Q9Y6J8-1]
CCDS83193.1 [Q9Y6J8-4]
RefSeqiNP_001304714.1, NM_001317785.1 [Q9Y6J8-1]
NP_001304715.1, NM_001317786.1 [Q9Y6J8-1]
NP_001304716.1, NM_001317787.1 [Q9Y6J8-4]
NP_001304717.1, NM_001317788.1
NP_001304718.1, NM_001317789.1
NP_057170.1, NM_016086.2 [Q9Y6J8-1]
XP_011514595.1, XM_011516293.2 [Q9Y6J8-1]
UniGeneiHs.11615

3D structure databases

ProteinModelPortaliQ9Y6J8
SMRiQ9Y6J8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119663, 13 interactors
STRINGi9606.ENSP00000248600

PTM databases

DEPODiQ9Y6J8
iPTMnetiQ9Y6J8
PhosphoSitePlusiQ9Y6J8

Polymorphism and mutation databases

BioMutaiSTYXL1
DMDMi29840801

Proteomic databases

PaxDbiQ9Y6J8
PeptideAtlasiQ9Y6J8
PRIDEiQ9Y6J8
ProteomicsDBi86702
86703 [Q9Y6J8-2]
86704 [Q9Y6J8-3]
86705 [Q9Y6J8-4]
86706 [Q9Y6J8-5]

Protocols and materials databases

DNASUi51657
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000248600; ENSP00000248600; ENSG00000127952 [Q9Y6J8-1]
ENST00000340062; ENSP00000343383; ENSG00000127952 [Q9Y6J8-4]
ENST00000359697; ENSP00000352726; ENSG00000127952 [Q9Y6J8-1]
ENST00000360591; ENSP00000353798; ENSG00000127952 [Q9Y6J8-4]
ENST00000431581; ENSP00000392221; ENSG00000127952 [Q9Y6J8-1]
GeneIDi51657
KEGGihsa:51657
UCSCiuc003uek.5 human [Q9Y6J8-1]

Organism-specific databases

CTDi51657
DisGeNETi51657
EuPathDBiHostDB:ENSG00000127952.16
GeneCardsiSTYXL1
HGNCiHGNC:18165 STYXL1
HPAiHPA050261
neXtProtiNX_Q9Y6J8
OpenTargetsiENSG00000127952
PharmGKBiPA134942462
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1716 Eukaryota
COG2453 LUCA
GeneTreeiENSGT00390000010113
HOGENOMiHOG000004828
HOVERGENiHBG052516
InParanoidiQ9Y6J8
KOiK18047
OMAiRPNRGFV
OrthoDBiEOG091G0JOE
PhylomeDBiQ9Y6J8
TreeFamiTF352452

Miscellaneous databases

ChiTaRSiSTYXL1 human
GeneWikiiSTYXL1
GenomeRNAii51657
PROiPR:Q9Y6J8

Gene expression databases

BgeeiENSG00000127952 Expressed in 208 organ(s), highest expression level in right uterine tube
CleanExiHS_STYXL1
ExpressionAtlasiQ9Y6J8 baseline and differential
GenevisibleiQ9Y6J8 HS

Family and domain databases

Gene3Di3.40.250.10, 1 hit
3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR000340 Dual-sp_phosphatase_cat-dom
IPR024950 DUSP
IPR029021 Prot-tyrosine_phosphatase-like
IPR001763 Rhodanese-like_dom
IPR036873 Rhodanese-like_dom_sf
IPR020422 TYR_PHOSPHATASE_DUAL_dom
PANTHERiPTHR10159 PTHR10159, 1 hit
PfamiView protein in Pfam
PF00782 DSPc, 1 hit
PF00581 Rhodanese, 1 hit
SMARTiView protein in SMART
SM00195 DSPc, 1 hit
SM00450 RHOD, 1 hit
SUPFAMiSSF52799 SSF52799, 1 hit
SSF52821 SSF52821, 1 hit
PROSITEiView protein in PROSITE
PS50054 TYR_PHOSPHATASE_DUAL, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSTYL1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y6J8
Secondary accession number(s): Q9UBP1
, Q9UK06, Q9UK07, Q9UKG2, Q9UKG3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 28, 2003
Last sequence update: November 1, 1999
Last modified: September 12, 2018
This is version 152 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again