Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9Y6I7 (WSB1_HUMAN)

Protein

WD repeat and SOCS box-containing protein 1

Gene

WSB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes type II iodothyronine deiodinase/DIO2. Confers constitutive instability to HIPK2 through proteasomal degradation.3 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processUbl conjugation pathway

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-8951664 Neddylation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q9Y6I7

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q9Y6I7

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...UniPathwayi
UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
WD repeat and SOCS box-containing protein 1
Short name:
WSB-1
Alternative name(s):
SOCS box-containing WD protein SWiP-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:WSB1
Synonyms:SWIP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000109046.14

Human Gene Nomenclature Database

More...HGNCi		HGNC:19221 WSB1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		610091 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9Y6I7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		26118

Open Targets

More...OpenTargetsi		ENSG00000109046

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134867554

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		WSB1

Domain mapping of disease mutations (DMDM)

More...DMDMi		20532298

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000514571 – 421WD repeat and SOCS box-containing protein 1Add BLAST421

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9Y6I7

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9Y6I7

PeptideAtlas

More...PeptideAtlasi		Q9Y6I7

PRoteomics IDEntifications database

More...PRIDEi		Q9Y6I7

ProteomicsDB human proteome resource

More...ProteomicsDBi		86693
86694 [Q9Y6I7-2]
86695 [Q9Y6I7-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9Y6I7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9Y6I7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000109046 Expressed in 235 organ(s), highest expression level in upper lobe of lung

CleanEx database of gene expression profiles

More...CleanExi		HS_WSB1

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9Y6I7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9Y6I7 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA003293

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with DIO2. Component of the probable ECS(WSB1) E3 ubiquitin ligase complex which contains CUL5, RNF7/RBX2, Elongin BC complex and WSB1. Component of a probable ECS-like E3 ubiquitin-protein ligase complex which contains CUL5, RBX1, Elongin BC complex and WSB1. Interacts with CUL5, RNF7, ELOB and ELOC. Binds to HIPK2 through WD40 repeats.3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		117560, 16 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q9Y6I7

Protein interaction database and analysis system

More...IntActi		Q9Y6I7, 6 interactors

Molecular INTeraction database

More...MINTi		Q9Y6I7

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000262394

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		Q9Y6I7

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati32 – 71WD 1Add BLAST40
Repeati124 – 165WD 2Add BLAST42
Repeati168 – 208WD 3Add BLAST41
Repeati212 – 251WD 4Add BLAST40
Repeati254 – 293WD 5Add BLAST40
Repeati309 – 346WD 6Add BLAST38
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini372 – 421SOCS boxPROSITE-ProRule annotationAdd BLAST50

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin ligase complexes.By similarity

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410IQ0Y Eukaryota
ENOG411010D LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00890000139406

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000063727

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG070207

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9Y6I7

KEGG Orthology (KO)

More...KOi		K10341

Identification of Orthologs from Complete Genome Data

More...OMAi		GHHNDVV

Database of Orthologous Groups

More...OrthoDBi		EOG091G06GY

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9Y6I7

TreeFam database of animal gene trees

More...TreeFami		TF329216

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.130.10.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR020472 G-protein_beta_WD-40_rep
IPR001496 SOCS_box
IPR036036 SOCS_box-like_dom_sf
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF07525 SOCS_box, 1 hit
PF00400 WD40, 5 hits

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00320 GPROTEINBRPT

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00253 SOCS, 1 hit
SM00969 SOCS_box, 1 hit
SM00320 WD40, 6 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF158235 SSF158235, 1 hit
SSF50978 SSF50978, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50225 SOCS, 1 hit
PS00678 WD_REPEATS_1, 2 hits
PS50082 WD_REPEATS_2, 6 hits
PS50294 WD_REPEATS_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y6I7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASFPPRVNE KEIVRLRTIG ELLAPAAPFD KKCGRENWTV AFAPDGSYFA 
        60         70         80         90        100
WSQGHRTVKL VPWSQCLQNF LLHGTKNVTN SSSLRLPRQN SDGGQKNKPR 
       110        120        130        140        150
EHIIDCGDIV WSLAFGSSVP EKQSRCVNIE WHRFRFGQDQ LLLATGLNNG 
       160        170        180        190        200
RIKIWDVYTG KLLLNLVDHT EVVRDLTFAP DGSLILVSAS RDKTLRVWDL 
       210        220        230        240        250
KDDGNMMKVL RGHQNWVYSC AFSPDSSMLC SVGASKAVFL WNMDKYTMIR 
       260        270        280        290        300
KLEGHHHDVV ACDFSPDGAL LATASYDTRV YIWDPHNGDI LMEFGHLFPP 
       310        320        330        340        350
PTPIFAGGAN DRWVRSVSFS HDGLHVASLA DDKMVRFWRI DEDYPVQVAP 
       360        370        380        390        400
LSNGLCCAFS TDGSVLAAGT HDGSVYFWAT PRQVPSLQHL CRMSIRRVMP 
       410        420 
TQEVQELPIP SKLLEFLSYR I
Length:421
Mass (Da):47,432
Last modified:November 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i650D4942E97D4BED
GO
Isoform 2 (identifier: Q9Y6I7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     14-159: Missing.

Show »
Length:275
Mass (Da):30,883
Checksum:i8F3B7D4C581CBD3D
GO
Isoform 3 (identifier: Q9Y6I7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     239-244: FLWNMD → VAAILV
     245-421: Missing.

Show »
Length:244
Mass (Da):27,295
Checksum:iE3D403F3CEB81109
GO
Isoform 4 (identifier: Q9Y6I7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASFPPRVNEKEIVRLRTIGELLAPAAPFDKKCGR → MLNIILIKFSSFSIRCAILSSVCLNEAITFAFLLQ
     36-237: Missing.

Show »
Length:219
Mass (Da):24,724
Checksum:i832E6744DD6F23DC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KT03J3KT03_HUMAN
WD repeat and SOCS box-containing p...
WSB1
207Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B4DGB8B4DGB8_HUMAN
cDNA FLJ58059, highly similar to WD...
WSB1
213Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B4DTL1B4DTL1_HUMAN
cDNA FLJ59301, highly similar to WD...
WSB1
247Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KTB3J3KTB3_HUMAN
WD repeat and SOCS box-containing p...
WSB1
143Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KRG6J3KRG6_HUMAN
WD repeat and SOCS box-containing p...
WSB1
98Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KSQ3J3KSQ3_HUMAN
WD repeat and SOCS box-containing p...
WSB1
54Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QLM8J3QLM8_HUMAN
WD repeat and SOCS box-containing p...
WSB1
74Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KS88J3KS88_HUMAN
WD repeat and SOCS box-containing p...
WSB1
78Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti149N → S in CAB53708 (PubMed:17974005).Curated1
Sequence conflicti171E → G in CAB53708 (PubMed:17974005).Curated1
Sequence conflicti178F → L in AAD43036 (Ref. 6) Curated1
Sequence conflicti201K → R in CAB53708 (PubMed:17974005).Curated1
Sequence conflicti231S → P in AAD43036 (Ref. 6) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02470116L → S2 PublicationsCorresponds to variant dbSNP:rs6561Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0534021 – 35MASFP…KKCGR → MLNIILIKFSSFSIRCAILS SVCLNEAITFAFLLQ in isoform 4. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_00679214 – 159Missing in isoform 2. 1 PublicationAdd BLAST146
Alternative sequenceiVSP_05340336 – 237Missing in isoform 4. 1 PublicationAdd BLAST202
Alternative sequenceiVSP_039111239 – 244FLWNMD → VAAILV in isoform 3. 1 Publication6
Alternative sequenceiVSP_039112245 – 421Missing in isoform 3. 1 PublicationAdd BLAST177

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF072880 mRNA Translation: AAD28808.1
AF106684 mRNA Translation: AAD43037.1
AF069313 mRNA Translation: AAD20954.2
AF240696 mRNA Translation: AAF82746.1
AL110243 mRNA Translation: CAB53693.1
AF112205 mRNA Translation: AAF17193.1
AF106683 mRNA Translation: AAD43036.1
AL110269 mRNA Translation: CAB53708.2
BC021110 mRNA Translation: AAH21110.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS11220.1 [Q9Y6I7-1]
CCDS11221.1 [Q9Y6I7-2]

Protein sequence database of the Protein Information Resource

More...PIRi		T14773
T14788

NCBI Reference Sequences

More...RefSeqi		NP_056441.6, NM_015626.9 [Q9Y6I7-1]
NP_599027.1, NM_134265.3 [Q9Y6I7-2]
XP_016879924.1, XM_017024435.1 [Q9Y6I7-4]
XP_016879925.1, XM_017024436.1 [Q9Y6I7-4]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.446017
Hs.655024

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000262394; ENSP00000262394; ENSG00000109046 [Q9Y6I7-1]
ENST00000348811; ENSP00000327055; ENSG00000109046 [Q9Y6I7-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		26118

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:26118

UCSC genome browser

More...UCSCi		uc002gzd.2 human [Q9Y6I7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF072880 mRNA Translation: AAD28808.1
AF106684 mRNA Translation: AAD43037.1
AF069313 mRNA Translation: AAD20954.2
AF240696 mRNA Translation: AAF82746.1
AL110243 mRNA Translation: CAB53693.1
AF112205 mRNA Translation: AAF17193.1
AF106683 mRNA Translation: AAD43036.1
AL110269 mRNA Translation: CAB53708.2
BC021110 mRNA Translation: AAH21110.1
CCDSiCCDS11220.1 [Q9Y6I7-1]
CCDS11221.1 [Q9Y6I7-2]
PIRiT14773
T14788
RefSeqiNP_056441.6, NM_015626.9 [Q9Y6I7-1]
NP_599027.1, NM_134265.3 [Q9Y6I7-2]
XP_016879924.1, XM_017024435.1 [Q9Y6I7-4]
XP_016879925.1, XM_017024436.1 [Q9Y6I7-4]
UniGeneiHs.446017
Hs.655024

3D structure databases

ProteinModelPortaliQ9Y6I7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117560, 16 interactors
CORUMiQ9Y6I7
IntActiQ9Y6I7, 6 interactors
MINTiQ9Y6I7
STRINGi9606.ENSP00000262394

PTM databases

iPTMnetiQ9Y6I7
PhosphoSitePlusiQ9Y6I7

Polymorphism and mutation databases

BioMutaiWSB1
DMDMi20532298

Proteomic databases

EPDiQ9Y6I7
PaxDbiQ9Y6I7
PeptideAtlasiQ9Y6I7
PRIDEiQ9Y6I7
ProteomicsDBi86693
86694 [Q9Y6I7-2]
86695 [Q9Y6I7-3]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		26118
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262394; ENSP00000262394; ENSG00000109046 [Q9Y6I7-1]
ENST00000348811; ENSP00000327055; ENSG00000109046 [Q9Y6I7-2]
GeneIDi26118
KEGGihsa:26118
UCSCiuc002gzd.2 human [Q9Y6I7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		26118
DisGeNETi26118
EuPathDBiHostDB:ENSG00000109046.14

GeneCards: human genes, protein and diseases

More...GeneCardsi		WSB1
HGNCiHGNC:19221 WSB1
HPAiHPA003293
MIMi610091 gene
neXtProtiNX_Q9Y6I7
OpenTargetsiENSG00000109046
PharmGKBiPA134867554

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410IQ0Y Eukaryota
ENOG411010D LUCA
GeneTreeiENSGT00890000139406
HOGENOMiHOG000063727
HOVERGENiHBG070207
InParanoidiQ9Y6I7
KOiK10341
OMAiGHHNDVV
OrthoDBiEOG091G06GY
PhylomeDBiQ9Y6I7
TreeFamiTF329216

Enzyme and pathway databases

UniPathwayi
UPA00143

ReactomeiR-HSA-8951664 Neddylation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SignaLinkiQ9Y6I7
SIGNORiQ9Y6I7

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		WSB1 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		WSB1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		26118

Protein Ontology

More...PROi		PR:Q9Y6I7

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000109046 Expressed in 235 organ(s), highest expression level in upper lobe of lung
CleanExiHS_WSB1
ExpressionAtlasiQ9Y6I7 baseline and differential
GenevisibleiQ9Y6I7 HS

Family and domain databases

Gene3Di2.130.10.10, 2 hits
InterProiView protein in InterPro
IPR020472 G-protein_beta_WD-40_rep
IPR001496 SOCS_box
IPR036036 SOCS_box-like_dom_sf
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF07525 SOCS_box, 1 hit
PF00400 WD40, 5 hits
PRINTSiPR00320 GPROTEINBRPT
SMARTiView protein in SMART
SM00253 SOCS, 1 hit
SM00969 SOCS_box, 1 hit
SM00320 WD40, 6 hits
SUPFAMiSSF158235 SSF158235, 1 hit
SSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS50225 SOCS, 1 hit
PS00678 WD_REPEATS_1, 2 hits
PS50082 WD_REPEATS_2, 6 hits
PS50294 WD_REPEATS_REGION, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiWSB1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y6I7
Secondary accession number(s): Q9NRB1
, Q9UBH9, Q9UG25, Q9UNN6, Q9Y656
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2002
Last sequence update: November 1, 1999
Last modified: November 7, 2018
This is version 172 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again