Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

WD repeat and SOCS box-containing protein 1

Gene

WSB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes type II iodothyronine deiodinase/DIO2. Confers constitutive instability to HIPK2 through proteasomal degradation.3 Publications

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processUbl conjugation pathway

Enzyme and pathway databases

ReactomeiR-HSA-8951664 Neddylation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SignaLinkiQ9Y6I7
SIGNORiQ9Y6I7
UniPathwayi
UPA00143

Names & Taxonomyi

Protein namesi
Recommended name:
WD repeat and SOCS box-containing protein 1
Short name:
WSB-1
Alternative name(s):
SOCS box-containing WD protein SWiP-1
Gene namesi
Name:WSB1
Synonyms:SWIP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000109046.14
HGNCiHGNC:19221 WSB1
MIMi610091 gene
neXtProtiNX_Q9Y6I7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi26118
OpenTargetsiENSG00000109046
PharmGKBiPA134867554

Polymorphism and mutation databases

BioMutaiWSB1
DMDMi20532298

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000514571 – 421WD repeat and SOCS box-containing protein 1Add BLAST421

Proteomic databases

EPDiQ9Y6I7
PaxDbiQ9Y6I7
PeptideAtlasiQ9Y6I7
PRIDEiQ9Y6I7
ProteomicsDBi86693
86694 [Q9Y6I7-2]
86695 [Q9Y6I7-3]

PTM databases

iPTMnetiQ9Y6I7
PhosphoSitePlusiQ9Y6I7

Expressioni

Gene expression databases

BgeeiENSG00000109046 Expressed in 235 organ(s), highest expression level in upper lobe of lung
CleanExiHS_WSB1
ExpressionAtlasiQ9Y6I7 baseline and differential
GenevisibleiQ9Y6I7 HS

Organism-specific databases

HPAiHPA003293

Interactioni

Subunit structurei

Interacts with DIO2. Component of the probable ECS(WSB1) E3 ubiquitin ligase complex which contains CUL5, RNF7/RBX2, Elongin BC complex and WSB1. Component of a probable ECS-like E3 ubiquitin-protein ligase complex which contains CUL5, RBX1, Elongin BC complex and WSB1. Interacts with CUL5, RNF7, ELOB and ELOC. Binds to HIPK2 through WD40 repeats.3 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi117560, 16 interactors
CORUMiQ9Y6I7
IntActiQ9Y6I7, 6 interactors
MINTiQ9Y6I7
STRINGi9606.ENSP00000262394

Structurei

3D structure databases

ProteinModelPortaliQ9Y6I7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati32 – 71WD 1Add BLAST40
Repeati124 – 165WD 2Add BLAST42
Repeati168 – 208WD 3Add BLAST41
Repeati212 – 251WD 4Add BLAST40
Repeati254 – 293WD 5Add BLAST40
Repeati309 – 346WD 6Add BLAST38
Domaini372 – 421SOCS boxPROSITE-ProRule annotationAdd BLAST50

Domaini

The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin ligase complexes.By similarity

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiENOG410IQ0Y Eukaryota
ENOG411010D LUCA
GeneTreeiENSGT00890000139406
HOGENOMiHOG000063727
HOVERGENiHBG070207
InParanoidiQ9Y6I7
KOiK10341
OMAiGHHNDVV
OrthoDBiEOG091G06GY
PhylomeDBiQ9Y6I7
TreeFamiTF329216

Family and domain databases

Gene3Di2.130.10.10, 2 hits
InterProiView protein in InterPro
IPR020472 G-protein_beta_WD-40_rep
IPR001496 SOCS_box
IPR036036 SOCS_box-like_dom_sf
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF07525 SOCS_box, 1 hit
PF00400 WD40, 5 hits
PRINTSiPR00320 GPROTEINBRPT
SMARTiView protein in SMART
SM00253 SOCS, 1 hit
SM00969 SOCS_box, 1 hit
SM00320 WD40, 6 hits
SUPFAMiSSF158235 SSF158235, 1 hit
SSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS50225 SOCS, 1 hit
PS00678 WD_REPEATS_1, 2 hits
PS50082 WD_REPEATS_2, 6 hits
PS50294 WD_REPEATS_REGION, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y6I7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASFPPRVNE KEIVRLRTIG ELLAPAAPFD KKCGRENWTV AFAPDGSYFA
60 70 80 90 100
WSQGHRTVKL VPWSQCLQNF LLHGTKNVTN SSSLRLPRQN SDGGQKNKPR
110 120 130 140 150
EHIIDCGDIV WSLAFGSSVP EKQSRCVNIE WHRFRFGQDQ LLLATGLNNG
160 170 180 190 200
RIKIWDVYTG KLLLNLVDHT EVVRDLTFAP DGSLILVSAS RDKTLRVWDL
210 220 230 240 250
KDDGNMMKVL RGHQNWVYSC AFSPDSSMLC SVGASKAVFL WNMDKYTMIR
260 270 280 290 300
KLEGHHHDVV ACDFSPDGAL LATASYDTRV YIWDPHNGDI LMEFGHLFPP
310 320 330 340 350
PTPIFAGGAN DRWVRSVSFS HDGLHVASLA DDKMVRFWRI DEDYPVQVAP
360 370 380 390 400
LSNGLCCAFS TDGSVLAAGT HDGSVYFWAT PRQVPSLQHL CRMSIRRVMP
410 420
TQEVQELPIP SKLLEFLSYR I
Length:421
Mass (Da):47,432
Last modified:November 1, 1999 - v1
Checksum:i650D4942E97D4BED
GO
Isoform 2 (identifier: Q9Y6I7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     14-159: Missing.

Show »
Length:275
Mass (Da):30,883
Checksum:i8F3B7D4C581CBD3D
GO
Isoform 3 (identifier: Q9Y6I7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     239-244: FLWNMD → VAAILV
     245-421: Missing.

Show »
Length:244
Mass (Da):27,295
Checksum:iE3D403F3CEB81109
GO
Isoform 4 (identifier: Q9Y6I7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASFPPRVNEKEIVRLRTIGELLAPAAPFDKKCGR → MLNIILIKFSSFSIRCAILSSVCLNEAITFAFLLQ
     36-237: Missing.

Show »
Length:219
Mass (Da):24,724
Checksum:i832E6744DD6F23DC
GO

Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KT03J3KT03_HUMAN
WD repeat and SOCS box-containing p...
WSB1
207Annotation score:
B4DGB8B4DGB8_HUMAN
cDNA FLJ58059, highly similar to WD...
WSB1
213Annotation score:
B4DTL1B4DTL1_HUMAN
cDNA FLJ59301, highly similar to WD...
WSB1
247Annotation score:
J3KTB3J3KTB3_HUMAN
WD repeat and SOCS box-containing p...
WSB1
143Annotation score:
J3KRG6J3KRG6_HUMAN
WD repeat and SOCS box-containing p...
WSB1
98Annotation score:
J3KSQ3J3KSQ3_HUMAN
WD repeat and SOCS box-containing p...
WSB1
54Annotation score:
J3QLM8J3QLM8_HUMAN
WD repeat and SOCS box-containing p...
WSB1
74Annotation score:
J3KS88J3KS88_HUMAN
WD repeat and SOCS box-containing p...
WSB1
78Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti149N → S in CAB53708 (PubMed:17974005).Curated1
Sequence conflicti171E → G in CAB53708 (PubMed:17974005).Curated1
Sequence conflicti178F → L in AAD43036 (Ref. 6) Curated1
Sequence conflicti201K → R in CAB53708 (PubMed:17974005).Curated1
Sequence conflicti231S → P in AAD43036 (Ref. 6) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02470116L → S2 PublicationsCorresponds to variant dbSNP:rs6561Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0534021 – 35MASFP…KKCGR → MLNIILIKFSSFSIRCAILS SVCLNEAITFAFLLQ in isoform 4. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_00679214 – 159Missing in isoform 2. 1 PublicationAdd BLAST146
Alternative sequenceiVSP_05340336 – 237Missing in isoform 4. 1 PublicationAdd BLAST202
Alternative sequenceiVSP_039111239 – 244FLWNMD → VAAILV in isoform 3. 1 Publication6
Alternative sequenceiVSP_039112245 – 421Missing in isoform 3. 1 PublicationAdd BLAST177

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF072880 mRNA Translation: AAD28808.1
AF106684 mRNA Translation: AAD43037.1
AF069313 mRNA Translation: AAD20954.2
AF240696 mRNA Translation: AAF82746.1
AL110243 mRNA Translation: CAB53693.1
AF112205 mRNA Translation: AAF17193.1
AF106683 mRNA Translation: AAD43036.1
AL110269 mRNA Translation: CAB53708.2
BC021110 mRNA Translation: AAH21110.1
CCDSiCCDS11220.1 [Q9Y6I7-1]
CCDS11221.1 [Q9Y6I7-2]
PIRiT14773
T14788
RefSeqiNP_056441.6, NM_015626.9 [Q9Y6I7-1]
NP_599027.1, NM_134265.3 [Q9Y6I7-2]
XP_016879924.1, XM_017024435.1 [Q9Y6I7-4]
XP_016879925.1, XM_017024436.1 [Q9Y6I7-4]
UniGeneiHs.446017
Hs.655024

Genome annotation databases

EnsembliENST00000262394; ENSP00000262394; ENSG00000109046 [Q9Y6I7-1]
ENST00000348811; ENSP00000327055; ENSG00000109046 [Q9Y6I7-2]
GeneIDi26118
KEGGihsa:26118
UCSCiuc002gzd.2 human [Q9Y6I7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF072880 mRNA Translation: AAD28808.1
AF106684 mRNA Translation: AAD43037.1
AF069313 mRNA Translation: AAD20954.2
AF240696 mRNA Translation: AAF82746.1
AL110243 mRNA Translation: CAB53693.1
AF112205 mRNA Translation: AAF17193.1
AF106683 mRNA Translation: AAD43036.1
AL110269 mRNA Translation: CAB53708.2
BC021110 mRNA Translation: AAH21110.1
CCDSiCCDS11220.1 [Q9Y6I7-1]
CCDS11221.1 [Q9Y6I7-2]
PIRiT14773
T14788
RefSeqiNP_056441.6, NM_015626.9 [Q9Y6I7-1]
NP_599027.1, NM_134265.3 [Q9Y6I7-2]
XP_016879924.1, XM_017024435.1 [Q9Y6I7-4]
XP_016879925.1, XM_017024436.1 [Q9Y6I7-4]
UniGeneiHs.446017
Hs.655024

3D structure databases

ProteinModelPortaliQ9Y6I7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117560, 16 interactors
CORUMiQ9Y6I7
IntActiQ9Y6I7, 6 interactors
MINTiQ9Y6I7
STRINGi9606.ENSP00000262394

PTM databases

iPTMnetiQ9Y6I7
PhosphoSitePlusiQ9Y6I7

Polymorphism and mutation databases

BioMutaiWSB1
DMDMi20532298

Proteomic databases

EPDiQ9Y6I7
PaxDbiQ9Y6I7
PeptideAtlasiQ9Y6I7
PRIDEiQ9Y6I7
ProteomicsDBi86693
86694 [Q9Y6I7-2]
86695 [Q9Y6I7-3]

Protocols and materials databases

DNASUi26118
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262394; ENSP00000262394; ENSG00000109046 [Q9Y6I7-1]
ENST00000348811; ENSP00000327055; ENSG00000109046 [Q9Y6I7-2]
GeneIDi26118
KEGGihsa:26118
UCSCiuc002gzd.2 human [Q9Y6I7-1]

Organism-specific databases

CTDi26118
DisGeNETi26118
EuPathDBiHostDB:ENSG00000109046.14
GeneCardsiWSB1
HGNCiHGNC:19221 WSB1
HPAiHPA003293
MIMi610091 gene
neXtProtiNX_Q9Y6I7
OpenTargetsiENSG00000109046
PharmGKBiPA134867554
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IQ0Y Eukaryota
ENOG411010D LUCA
GeneTreeiENSGT00890000139406
HOGENOMiHOG000063727
HOVERGENiHBG070207
InParanoidiQ9Y6I7
KOiK10341
OMAiGHHNDVV
OrthoDBiEOG091G06GY
PhylomeDBiQ9Y6I7
TreeFamiTF329216

Enzyme and pathway databases

UniPathwayi
UPA00143

ReactomeiR-HSA-8951664 Neddylation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SignaLinkiQ9Y6I7
SIGNORiQ9Y6I7

Miscellaneous databases

ChiTaRSiWSB1 human
GeneWikiiWSB1
GenomeRNAii26118
PROiPR:Q9Y6I7
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000109046 Expressed in 235 organ(s), highest expression level in upper lobe of lung
CleanExiHS_WSB1
ExpressionAtlasiQ9Y6I7 baseline and differential
GenevisibleiQ9Y6I7 HS

Family and domain databases

Gene3Di2.130.10.10, 2 hits
InterProiView protein in InterPro
IPR020472 G-protein_beta_WD-40_rep
IPR001496 SOCS_box
IPR036036 SOCS_box-like_dom_sf
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF07525 SOCS_box, 1 hit
PF00400 WD40, 5 hits
PRINTSiPR00320 GPROTEINBRPT
SMARTiView protein in SMART
SM00253 SOCS, 1 hit
SM00969 SOCS_box, 1 hit
SM00320 WD40, 6 hits
SUPFAMiSSF158235 SSF158235, 1 hit
SSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS50225 SOCS, 1 hit
PS00678 WD_REPEATS_1, 2 hits
PS50082 WD_REPEATS_2, 6 hits
PS50294 WD_REPEATS_REGION, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiWSB1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y6I7
Secondary accession number(s): Q9NRB1
, Q9UBH9, Q9UG25, Q9UNN6, Q9Y656
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2002
Last sequence update: November 1, 1999
Last modified: November 7, 2018
This is version 172 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  5. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again