Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Synphilin-1

Gene

SNCAIP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Isoform 2 inhibits the ubiquitin ligase activity of SIAH1 and inhibits proteasomal degradation of target proteins. Isoform 2 inhibits autoubiquitination and proteasomal degradation of SIAH1, and thereby increases cellular levels of SIAH. Isoform 2 modulates SNCA monoubiquitination by SIAH1.2 Publications

Miscellaneous

Constructs encoding portions of SNCA and SNCAIP co-transfected in mammalian cells promote cytosolic inclusions resembling the Lewy bodies of Parkinson disease. Coexpression of SNCA, SNCAIP, and PRKN result in the formation of Lewy body-like. ubiquitin-positive cytosolic inclusions. SNCAIP isoform 2 is particularly aggregation-prone. Familial mutations in PRKN disrupt the ubiquitination of SNCAIP and the formation of the ubiquitin-positive inclusions. These results provide a molecular basis for the ubiquitination of Lewy body-associated proteins and link PRKN and SNCA in a common pathogenic mechanism through their interaction with SNCAIP.

GO - Molecular functioni

  • identical protein binding Source: IntAct
  • ubiquitin protein ligase binding Source: UniProtKB

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-HSA-977225 Amyloid fiber formation
SIGNORiQ9Y6H5

Names & Taxonomyi

Protein namesi
Recommended name:
Synphilin-1
Short name:
Sph1
Alternative name(s):
Alpha-synuclein-interacting protein
Gene namesi
Name:SNCAIP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000064692.18
HGNCiHGNC:11139 SNCAIP
MIMi603779 gene
neXtProtiNX_Q9Y6H5

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Involvement in diseasei

Parkinson disease (PARK)1 Publication
Disease susceptibility may be associated with variations affecting the gene represented in this entry.
Disease descriptionA complex neurodegenerative disorder characterized by bradykinesia, resting tremor, muscular rigidity and postural instability. Additional features are characteristic postural abnormalities, dysautonomia, dystonic cramps, and dementia. The pathology of Parkinson disease involves the loss of dopaminergic neurons in the substantia nigra and the presence of Lewy bodies (intraneuronal accumulations of aggregated proteins), in surviving neurons in various areas of the brain. The disease is progressive and usually manifests after the age of 50 years, although early-onset cases (before 50 years) are known. The majority of the cases are sporadic suggesting a multifactorial etiology based on environmental and genetic factors. However, some patients present with a positive family history for the disease. Familial forms of the disease usually begin at earlier ages and are associated with atypical clinical features.
See also OMIM:168600

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi79V → N: Decreases interaction with SIAH1 and formation of cytoplasmic inclusion bodies; when associated with N-81. 1 Publication1
Mutagenesisi81P → N: Decreases interaction with SIAH1 and formation of cytoplasmic inclusion bodies; when associated with N-79. 1 Publication1

Keywords - Diseasei

Neurodegeneration, Parkinson disease, Parkinsonism

Organism-specific databases

DisGeNETi9627
GeneReviewsiSNCAIP
MalaCardsiSNCAIP
MIMi168600 phenotype
OpenTargetsiENSG00000064692
PharmGKBiPA35987

Chemistry databases

ChEMBLiCHEMBL1926494

Polymorphism and mutation databases

BioMutaiSNCAIP
DMDMi205831000

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000670681 – 919Synphilin-1Add BLAST919

Post-translational modificationi

Ubiquitinated; mediated by SIAH1, SIAH2 or RNF19A and leading to its subsequent proteasomal degradation. In the absence of proteasomal degradation, ubiquitinated SNCAIP accumulates in cytoplasmic inclusion bodies. Isoform 2 is subject to limited ubiquitination that does not lead to proteasomal degradation.3 Publications

Keywords - PTMi

Ubl conjugation

Proteomic databases

EPDiQ9Y6H5
PaxDbiQ9Y6H5
PeptideAtlasiQ9Y6H5
PRIDEiQ9Y6H5
ProteomicsDBi86680
86681 [Q9Y6H5-2]
86682 [Q9Y6H5-3]
86683 [Q9Y6H5-4]
86684 [Q9Y6H5-5]
86685 [Q9Y6H5-6]

PTM databases

iPTMnetiQ9Y6H5
PhosphoSitePlusiQ9Y6H5

Miscellaneous databases

PMAP-CutDBiQ9Y6H5

Expressioni

Tissue specificityi

Detected in brain (at protein level). Widely expressed, with highest levels in brain, heart and placenta.2 Publications

Gene expression databases

BgeeiENSG00000064692 Expressed in 197 organ(s), highest expression level in forebrain
CleanExiHS_SNCAIP
ExpressionAtlasiQ9Y6H5 baseline and differential
GenevisibleiQ9Y6H5 HS

Organism-specific databases

HPAiHPA064687

Interactioni

Subunit structurei

Homodimer (Probable). Heterodimer of isoform 1 and isoform 2 (Probable). Interacts with SIAH1, SIAH2, SNCA, RNF19A AND PRKN. Isoform 2 has a strong tendency to form aggregates and can sequester isoform 1.Curated8 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi114986, 35 interactors
CORUMiQ9Y6H5
DIPiDIP-61155N
IntActiQ9Y6H5, 14 interactors
MINTiQ9Y6H5
STRINGi9606.ENSP00000261368

Structurei

Secondary structure

1919
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9Y6H5
SMRiQ9Y6H5
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9Y6H5

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati349 – 380ANK 1Add BLAST32
Repeati384 – 413ANK 2Add BLAST30
Repeati419 – 448ANK 3Add BLAST30
Repeati456 – 485ANK 4Add BLAST30
Repeati603 – 632ANK 5Add BLAST30
Repeati699 – 729ANK 6Add BLAST31

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili515 – 552Sequence analysisAdd BLAST38

Keywords - Domaini

ANK repeat, Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG0504 Eukaryota
COG0666 LUCA
GeneTreeiENSGT00390000001485
HOVERGENiHBG061375
InParanoidiQ9Y6H5
KOiK04558
OMAiCRRCDSQ
OrthoDBiEOG091G0QOU
PhylomeDBiQ9Y6H5
TreeFamiTF329095

Family and domain databases

CDDicd00204 ANK, 1 hit
Gene3Di1.25.40.20, 1 hit
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR032027 SNCAIP_SNCA-bd
PfamiView protein in Pfam
PF12796 Ank_2, 2 hits
PF16700 SNCAIP_SNCA_bd, 1 hit
SMARTiView protein in SMART
SM00248 ANK, 4 hits
SUPFAMiSSF48403 SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 10 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: Q9Y6H5-1) [UniParc]FASTAAdd to basket
Also known as: 1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEAPEYLDLD EIDFSDDISY SVTSLKTIPE LCRRCDTQNE DRSVSSSSWN
60 70 80 90 100
CGISTLITNT QKPTGIADVY SKFRPVKRVS PLKHQPETLE NNESDDQKNQ
110 120 130 140 150
KVVEYQKGGE SDLGPQPQEL GPGDGVGGPP GKSSEPSTSL GELEHYDLDM
160 170 180 190 200
DEILDVPYIK SSQQLASFTK VTSEKRILGL CTTINGLSGK ACSTGSSESS
210 220 230 240 250
SSNMAPFCVL SPVKSPHLRK ASAVIHDQHK LSTEETEISP PLVKCGSAYE
260 270 280 290 300
PENQSKDFLN KTFSDPHGRK VEKTTPDCQL RAFHLQSSAA ESKPEEQVSG
310 320 330 340 350
LNRTSSQGPE ERSEYLKKVK SILNIVKEGQ ISLLPHLAAD NLDKIHDENG
360 370 380 390 400
NNLLHIAASQ GHAECLQHLT SLMGEDCLNE RNTEKLTPAG LAIKNGQLEC
410 420 430 440 450
VRWMVSETEA IAELSCSKDF PSLIHYAGCY GQEKILLWLL QFMQEQGISL
460 470 480 490 500
DEVDQDGNSA VHVASQHGYL GCIQTLVEYG ANVTMQNHAG EKPSQSAERQ
510 520 530 540 550
GHTLCSRYLV VVETCMSLAS QVVKLTKQLK EQTVERVTLQ NQLQQFLEAQ
560 570 580 590 600
KSEGKSLPSS PSSPSSPASR KSQWKSPDAD DDSVAKSKPG VQEGIQVLGS
610 620 630 640 650
LSASSRARPK AKDEDSDKIL RQLLGKEISE NVCTQEKLSL EFQDAQASSR
660 670 680 690 700
NSKKIPLEKR ELKLARLRQL MQRSLSESDT DSNNSEDPKT TPVRKADRPR
710 720 730 740 750
PQPIVESVES MDSAESLHLM IKKHTLASGG RRFPFSIKAS KSLDGHSPSP
760 770 780 790 800
TSESSEPDLE SQYPGSGSIP PNQPSGDPQQ PSPDSTAAQK VATSPKSALK
810 820 830 840 850
SPSSKRRTSQ NLKLRVTFEE PVVQMEQPSL ELNGEKDKDK GRTLQRTSTS
860 870 880 890 900
NESGDQLKRP FGAFRSIMET LSGNQNNNNN YQAANQLKTS TLPLTSLGRK
910
TDAKGNPASS ASKGKNKAA
Length:919
Mass (Da):100,409
Last modified:July 22, 2008 - v2
Checksum:i55C5316F250D0480
GO
Isoform 2 (identifier: Q9Y6H5-2) [UniParc]FASTAAdd to basket
Also known as: Synphilin-1A

The sequence of this isoform differs from the canonical sequence as follows:
     1-366: Missing.
     367-394: QHLTSLMGEDCLNERNTEKLTPAGLAIK → MTYLIQSHHSRRSQNCAEDVIRKTKTDQ
     919-919: A → EMYSSCINLSSNMLIEEHLCNDTRHNDINRKMKKSYSIKHIAEPESKELFL

Show »
Length:603
Mass (Da):66,646
Checksum:i3C41F69D861CE493
GO
Isoform 3 (identifier: Q9Y6H5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: S → SDNRSQGNRLQKLGLEDTDREDAMGFGSHRAKLTVVAALGACHCPENE
     919-919: A → EMYSSCINLSSNMLIEEHLCNDTRHNDINRKMKKSYSIKHIAEPESKELFL

Show »
Length:1,016
Mass (Da):111,455
Checksum:i6EC840B66BA8217D
GO
Isoform 4 (identifier: Q9Y6H5-4) [UniParc]FASTAAdd to basket
Also known as: 1b

The sequence of this isoform differs from the canonical sequence as follows:
     335-394: Missing.

Show »
Length:859
Mass (Da):93,930
Checksum:i949D53FF98FCE6E6
GO
Isoform 5 (identifier: Q9Y6H5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-366: Missing.
     367-394: QHLTSLMGEDCLNERNTEKLTPAGLAIK → MTYLIQSHHSRRSQNCAEDVIRKTKTDQ

Show »
Length:553
Mass (Da):60,693
Checksum:iEAEBC23FCD35545A
GO
Isoform 6 (identifier: Q9Y6H5-6) [UniParc]FASTAAdd to basket
Also known as: 1c

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: S → SDNRSQGNRLQKLGLEDTDREDAMGFGSHRAKLTVVAALGACHCPENE
     476-541: LVEYGANVTM...QTVERVTLQN → RLKIQGTWNG...NQLPETKSSY
     542-919: Missing.

Show »
Length:588
Mass (Da):64,469
Checksum:iEBF343E479576255
GO

Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6R9G8D6R9G8_HUMAN
Synphilin-1
SNCAIP
858Annotation score:
Q6L983Q6L983_HUMAN
Synphilin-1d protein
SNCAIP
113Annotation score:
Q6L981Q6L981_HUMAN
Synphilin-1f protein
SNCAIP
88Annotation score:
Q6L982Q6L982_HUMAN
Synphilin-1e protein
SNCAIP
66Annotation score:
D6RBR2D6RBR2_HUMAN
Synphilin-1
SNCAIP
98Annotation score:
Q6L980Q6L980_HUMAN
Synphilin-1g protein
SNCAIP
62Annotation score:
D6RFL3D6RFL3_HUMAN
Synphilin-1
SNCAIP
160Annotation score:
D6RD29D6RD29_HUMAN
Synphilin-1
SNCAIP
135Annotation score:
D6REC1D6REC1_HUMAN
Synphilin-1
SNCAIP
67Annotation score:
D6RHX3D6RHX3_HUMAN
Synphilin-1
SNCAIP
14Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti188S → F in AAH40552 (PubMed:15489334).Curated1
Sequence conflicti614E → G in AAH40552 (PubMed:15489334).Curated1
Sequence conflicti696A → G in AAH40552 (PubMed:15489334).Curated1
Sequence conflicti712D → G in AAH94759 (PubMed:15489334).Curated1
Sequence conflicti801S → P in AAH33743 (PubMed:15489334).Curated1
Sequence conflicti919A → E in AAH94759 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06535844V → A3 PublicationsCorresponds to variant dbSNP:rs56285021Ensembl.1
Natural variantiVAR_048312235E → G. Corresponds to variant dbSNP:rs6867105Ensembl.1
Natural variantiVAR_025667621R → C Found in patients with symptoms of Parkinson disease; unknown pathological significance; reduced number of cytoplasmic inclusions in cells expressing C-621 compared with cells expressing wild-type (wt) protein when subjected to proteasomal inhibition; C-621 transfected cells are more susceptible to staurosporine-induced cell death than cells expressin wt protein. 2 PublicationsCorresponds to variant dbSNP:rs28937592EnsemblClinVar.1
Natural variantiVAR_065359706E → Q1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0388391 – 366Missing in isoform 2 and isoform 5. 2 PublicationsAdd BLAST366
Alternative sequenceiVSP_03884019S → SDNRSQGNRLQKLGLEDTDR EDAMGFGSHRAKLTVVAALG ACHCPENE in isoform 3 and isoform 6. 2 Publications1
Alternative sequenceiVSP_038841335 – 394Missing in isoform 4. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_038842367 – 394QHLTS…GLAIK → MTYLIQSHHSRRSQNCAEDV IRKTKTDQ in isoform 2 and isoform 5. 2 PublicationsAdd BLAST28
Alternative sequenceiVSP_038843476 – 541LVEYG…VTLQN → RLKIQGTWNGSETCLFTHHF SSYPPISSGLQCQGQEGVLF IPDQVGAATNKQVLFQNQLP ETKSSY in isoform 6. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_038844542 – 919Missing in isoform 6. 1 PublicationAdd BLAST378
Alternative sequenceiVSP_038845919A → EMYSSCINLSSNMLIEEHLC NDTRHNDINRKMKKSYSIKH IAEPESKELFL in isoform 2 and isoform 3. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF076929 mRNA Translation: AAD30362.1
AF167306
, AF167301, AF167302, AF167303, AF167304, AF167305 Genomic DNA Translation: AAG17478.1
DQ227317 mRNA Translation: ABB51162.1
CH471086 Genomic DNA Translation: EAW48889.1
AB110788 mRNA Translation: BAD19017.1
AB110789 mRNA Translation: BAD19018.1
AB110790 mRNA Translation: BAD19019.1
CH471086 Genomic DNA Translation: EAW48890.1
BC033743 mRNA Translation: AAH33743.1
BC040552 mRNA Translation: AAH40552.1
BC094759 mRNA Translation: AAH94759.1
CCDSiCCDS4131.1 [Q9Y6H5-1]
CCDS58964.1 [Q9Y6H5-2]
CCDS78054.1 [Q9Y6H5-3]
RefSeqiNP_001229864.1, NM_001242935.2 [Q9Y6H5-2]
NP_001295029.1, NM_001308100.1 [Q9Y6H5-3]
NP_001295034.1, NM_001308105.1 [Q9Y6H5-4]
NP_001295035.1, NM_001308106.1
NP_001295036.1, NM_001308107.1 [Q9Y6H5-5]
NP_001295037.1, NM_001308108.1
NP_001295038.1, NM_001308109.1
NP_005451.2, NM_005460.3 [Q9Y6H5-1]
XP_011542039.1, XM_011543737.2 [Q9Y6H5-3]
XP_011542040.1, XM_011543738.2 [Q9Y6H5-3]
XP_011542041.1, XM_011543739.1 [Q9Y6H5-3]
XP_011542043.1, XM_011543741.2 [Q9Y6H5-3]
XP_011542045.1, XM_011543743.2 [Q9Y6H5-3]
XP_016865567.1, XM_017010078.1 [Q9Y6H5-3]
XP_016865571.1, XM_017010082.1 [Q9Y6H5-1]
UniGeneiHs.426463

Genome annotation databases

EnsembliENST00000261367; ENSP00000261367; ENSG00000064692 [Q9Y6H5-3]
ENST00000261368; ENSP00000261368; ENSG00000064692 [Q9Y6H5-1]
ENST00000379538; ENSP00000368854; ENSG00000064692 [Q9Y6H5-2]
ENST00000395469; ENSP00000378852; ENSG00000064692 [Q9Y6H5-6]
GeneIDi9627
KEGGihsa:9627
UCSCiuc003ksw.2 human [Q9Y6H5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF076929 mRNA Translation: AAD30362.1
AF167306
, AF167301, AF167302, AF167303, AF167304, AF167305 Genomic DNA Translation: AAG17478.1
DQ227317 mRNA Translation: ABB51162.1
CH471086 Genomic DNA Translation: EAW48889.1
AB110788 mRNA Translation: BAD19017.1
AB110789 mRNA Translation: BAD19018.1
AB110790 mRNA Translation: BAD19019.1
CH471086 Genomic DNA Translation: EAW48890.1
BC033743 mRNA Translation: AAH33743.1
BC040552 mRNA Translation: AAH40552.1
BC094759 mRNA Translation: AAH94759.1
CCDSiCCDS4131.1 [Q9Y6H5-1]
CCDS58964.1 [Q9Y6H5-2]
CCDS78054.1 [Q9Y6H5-3]
RefSeqiNP_001229864.1, NM_001242935.2 [Q9Y6H5-2]
NP_001295029.1, NM_001308100.1 [Q9Y6H5-3]
NP_001295034.1, NM_001308105.1 [Q9Y6H5-4]
NP_001295035.1, NM_001308106.1
NP_001295036.1, NM_001308107.1 [Q9Y6H5-5]
NP_001295037.1, NM_001308108.1
NP_001295038.1, NM_001308109.1
NP_005451.2, NM_005460.3 [Q9Y6H5-1]
XP_011542039.1, XM_011543737.2 [Q9Y6H5-3]
XP_011542040.1, XM_011543738.2 [Q9Y6H5-3]
XP_011542041.1, XM_011543739.1 [Q9Y6H5-3]
XP_011542043.1, XM_011543741.2 [Q9Y6H5-3]
XP_011542045.1, XM_011543743.2 [Q9Y6H5-3]
XP_016865567.1, XM_017010078.1 [Q9Y6H5-3]
XP_016865571.1, XM_017010082.1 [Q9Y6H5-1]
UniGeneiHs.426463

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KESNMR-A512-557[»]
ProteinModelPortaliQ9Y6H5
SMRiQ9Y6H5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114986, 35 interactors
CORUMiQ9Y6H5
DIPiDIP-61155N
IntActiQ9Y6H5, 14 interactors
MINTiQ9Y6H5
STRINGi9606.ENSP00000261368

Chemistry databases

ChEMBLiCHEMBL1926494

PTM databases

iPTMnetiQ9Y6H5
PhosphoSitePlusiQ9Y6H5

Polymorphism and mutation databases

BioMutaiSNCAIP
DMDMi205831000

Proteomic databases

EPDiQ9Y6H5
PaxDbiQ9Y6H5
PeptideAtlasiQ9Y6H5
PRIDEiQ9Y6H5
ProteomicsDBi86680
86681 [Q9Y6H5-2]
86682 [Q9Y6H5-3]
86683 [Q9Y6H5-4]
86684 [Q9Y6H5-5]
86685 [Q9Y6H5-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000261367; ENSP00000261367; ENSG00000064692 [Q9Y6H5-3]
ENST00000261368; ENSP00000261368; ENSG00000064692 [Q9Y6H5-1]
ENST00000379538; ENSP00000368854; ENSG00000064692 [Q9Y6H5-2]
ENST00000395469; ENSP00000378852; ENSG00000064692 [Q9Y6H5-6]
GeneIDi9627
KEGGihsa:9627
UCSCiuc003ksw.2 human [Q9Y6H5-1]

Organism-specific databases

CTDi9627
DisGeNETi9627
EuPathDBiHostDB:ENSG00000064692.18
GeneCardsiSNCAIP
GeneReviewsiSNCAIP
H-InvDBiHIX0005121
HIX0018508
HGNCiHGNC:11139 SNCAIP
HPAiHPA064687
MalaCardsiSNCAIP
MIMi168600 phenotype
603779 gene
neXtProtiNX_Q9Y6H5
OpenTargetsiENSG00000064692
PharmGKBiPA35987
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0504 Eukaryota
COG0666 LUCA
GeneTreeiENSGT00390000001485
HOVERGENiHBG061375
InParanoidiQ9Y6H5
KOiK04558
OMAiCRRCDSQ
OrthoDBiEOG091G0QOU
PhylomeDBiQ9Y6H5
TreeFamiTF329095

Enzyme and pathway databases

ReactomeiR-HSA-977225 Amyloid fiber formation
SIGNORiQ9Y6H5

Miscellaneous databases

ChiTaRSiSNCAIP human
EvolutionaryTraceiQ9Y6H5
GeneWikiiSNCAIP
GenomeRNAii9627
PMAP-CutDBiQ9Y6H5
PROiPR:Q9Y6H5
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000064692 Expressed in 197 organ(s), highest expression level in forebrain
CleanExiHS_SNCAIP
ExpressionAtlasiQ9Y6H5 baseline and differential
GenevisibleiQ9Y6H5 HS

Family and domain databases

CDDicd00204 ANK, 1 hit
Gene3Di1.25.40.20, 1 hit
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR032027 SNCAIP_SNCA-bd
PfamiView protein in Pfam
PF12796 Ank_2, 2 hits
PF16700 SNCAIP_SNCA_bd, 1 hit
SMARTiView protein in SMART
SM00248 ANK, 4 hits
SUPFAMiSSF48403 SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSNCAP_HUMAN
AccessioniPrimary (citable) accession number: Q9Y6H5
Secondary accession number(s): D3DSZ1
, Q05BS1, Q1PSC2, Q49AC6, Q504U9, Q6L984, Q6L985, Q6L986, Q9HC59
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: July 22, 2008
Last modified: September 12, 2018
This is version 162 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again