Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 174 (18 Sep 2019)
Sequence version 1 (01 Nov 1999)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Transcription factor ETV7

Gene

ETV7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional repressor; binds to the DNA sequence 5'-CCGGAAGT-3'. Isoform A does not seem to have a repressor activity. Isoform C does not seem to have a repressor activity.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi224 – 305ETSPROSITE-ProRule annotationAdd BLAST82

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Repressor
Biological processTranscription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transcription factor ETV7
Alternative name(s):
ETS translocation variant 7
ETS-related protein Tel2
Tel-related Ets factor
Transcription factor Tel-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ETV7
Synonyms:TEL2, TELB, TREF
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:18160 ETV7

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605255 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y603

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
51513

Open Targets

More...
OpenTargetsi
ENSG00000010030

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134980006

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9Y603

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ETV7

Domain mapping of disease mutations (DMDM)

More...
DMDMi
13124589

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002041231 – 341Transcription factor ETV7Add BLAST341

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9Y603

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y603

PeptideAtlas

More...
PeptideAtlasi
Q9Y603

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y603

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
5258
86561 [Q9Y603-1]
86562 [Q9Y603-2]
86563 [Q9Y603-3]
86564 [Q9Y603-4]
86565 [Q9Y603-5]
86566 [Q9Y603-6]
86567 [Q9Y603-7]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y603

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y603

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in hematopoietic tissues.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000010030 Expressed in 190 organ(s), highest expression level in buccal mucosa cell

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Y603 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA029033
HPA049689

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119581, 7 interactors

Protein interaction database and analysis system

More...
IntActi
Q9Y603, 6 interactors

Molecular INTeraction database

More...
MINTi
Q9Y603

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000341843

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Y603

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini33 – 117PNTPROSITE-ProRule annotationAdd BLAST85

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ETS family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3804 Eukaryota
ENOG4111K4J LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162211

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000012982

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y603

KEGG Orthology (KO)

More...
KOi
K03211

Identification of Orthologs from Complete Genome Data

More...
OMAi
RIQPSLW

Database of Orthologous Groups

More...
OrthoDBi
827924at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y603

TreeFam database of animal gene trees

More...
TreeFami
TF318679

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.10.10, 1 hit
1.10.150.50, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000418 Ets_dom
IPR003118 Pointed_dom
IPR013761 SAM/pointed_sf
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00178 Ets, 1 hit
PF02198 SAM_PNT, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00454 ETSDOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00413 ETS, 1 hit
SM00251 SAM_PNT, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46785 SSF46785, 1 hit
SSF47769 SSF47769, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00346 ETS_DOMAIN_2, 1 hit
PS50061 ETS_DOMAIN_3, 1 hit
PS51433 PNT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform B (identifier: Q9Y603-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQEGELAISP ISPVAAMPPL GTHVQARCEA QINLLGEGGI CKLPGRLRIQ
60 70 80 90 100
PALWSREDVL HWLRWAEQEY SLPCTAEHGF EMNGRALCIL TKDDFRHRAP
110 120 130 140 150
SSGDVLYELL QYIKTQRRAL VCGPFFGGIF RLKTPTQHSP VPPEEVTGPS
160 170 180 190 200
QMDTRRGHLL QPPDPGLTSN FGHLDDPGLA RWTPGKEESL NLCHCAELGC
210 220 230 240 250
RTQGVCSFPA MPQAPIDGRI ADCRLLWDYV YQLLLDTRYE PYIKWEDKDA
260 270 280 290 300
KIFRVVDPNG LARLWGNHKN RVNMTYEKMS RALRHYYKLN IIKKEPGQKL
310 320 330 340
LFRFLKTPGK MVQDKHSHLE PLESQEQDRI EFKDKRPEIS P
Length:341
Mass (Da):38,998
Last modified:November 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i941983E83E45EBED
GO
Isoform A (identifier: Q9Y603-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-102: MQEGELAISP...DDFRHRAPSS → MHRGARVRDE...RTGFPLSGNP

Show »
Length:282
Mass (Da):32,435
Checksum:iD922B683DF411B25
GO
Isoform C (identifier: Q9Y603-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.

Show »
Length:260
Mass (Da):30,012
Checksum:i5D3EA756175F8081
GO
Isoform D (identifier: Q9Y603-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-103: Missing.

Show »
Length:286
Mass (Da):32,590
Checksum:i897E85CAEC7909EA
GO
Isoform E (identifier: Q9Y603-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-341: FLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP → NGLQLIFIFIWSFQ

Show »
Length:317
Mass (Da):36,205
Checksum:iE7275D5E5B94FAF0
GO
Isoform F (identifier: Q9Y603-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-103: Missing.
     304-341: FLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP → NGLQLIFIFIWSFQ

Show »
Length:262
Mass (Da):29,797
Checksum:i2DAAA51DD32252CB
GO
Isoform G (identifier: Q9Y603-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     145-221: Missing.

Show »
Length:264
Mass (Da):30,763
Checksum:iDB80D0C445B70646
GO
Isoform H (identifier: Q9Y603-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-151: Missing.

Show »
Length:190
Mass (Da):22,186
Checksum:iF7A5B7235BA599C3
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti27R → T in AAF25007 (PubMed:10828014).Curated1
Sequence conflicti255V → G in AAF25007 (PubMed:10828014).Curated1
Sequence conflicti273N → D in AAF25007 (PubMed:10828014).Curated1
Sequence conflicti311M → T in AAF25007 (PubMed:10828014).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05925786A → T. Corresponds to variant dbSNP:rs9394345Ensembl.1
Natural variantiVAR_048952138H → Y. Corresponds to variant dbSNP:rs9470262Ensembl.1
Natural variantiVAR_048953199G → S. Corresponds to variant dbSNP:rs34306145Ensembl.1
Natural variantiVAR_020314212P → L. Corresponds to variant dbSNP:rs2234079Ensembl.1
Natural variantiVAR_048954250A → V. Corresponds to variant dbSNP:rs2234080Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0442851 – 151Missing in isoform H. 1 PublicationAdd BLAST151
Alternative sequenceiVSP_0014731 – 102MQEGE…RAPSS → MHRGARVRDERTRPLHPHQG RLPAPCAQLRSGKRTGFPLS GNP in isoform A. 1 PublicationAdd BLAST102
Alternative sequenceiVSP_0014741 – 81Missing in isoform C. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_00147549 – 103Missing in isoform D and isoform F. 2 PublicationsAdd BLAST55
Alternative sequenceiVSP_001476145 – 221Missing in isoform G. 1 PublicationAdd BLAST77
Alternative sequenceiVSP_001477304 – 341FLKTP…PEISP → NGLQLIFIFIWSFQ in isoform E and isoform F. 1 PublicationAdd BLAST38

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF116508 mRNA Translation: AAD43250.1
AF116509 mRNA Translation: AAD43251.1
AF116510 mRNA Translation: AAD43252.1
AF218235 mRNA Translation: AAF28350.1
AF218365 mRNA Translation: AAF44742.1
AF218366 mRNA Translation: AAF44743.1
AF175387 mRNA Translation: AAF25007.3
AF147782 mRNA Translation: AAD33989.1
AJ276205 mRNA Translation: CAC17012.1
AK122796 mRNA Translation: BAG53734.1
AK301011 mRNA Translation: BAG62628.1
AK303829 mRNA Translation: BAG64776.1
Z84484 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03885.1
CH471081 Genomic DNA Translation: EAX03888.1
CH471081 Genomic DNA Translation: EAX03890.1
BC035853 mRNA Translation: AAH35853.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4819.1 [Q9Y603-1]
CCDS56422.1 [Q9Y603-8]
CCDS56423.1 [Q9Y603-4]
CCDS56424.1 [Q9Y603-7]
CCDS56425.1 [Q9Y603-5]
CCDS75440.1 [Q9Y603-2]
CCDS75441.1 [Q9Y603-3]
CCDS78131.1 [Q9Y603-6]

NCBI Reference Sequences

More...
RefSeqi
NP_001193964.1, NM_001207035.1 [Q9Y603-5]
NP_001193965.1, NM_001207036.1 [Q9Y603-4]
NP_001193966.1, NM_001207037.1 [Q9Y603-2]
NP_001193967.1, NM_001207038.1 [Q9Y603-7]
NP_001193968.1, NM_001207039.1 [Q9Y603-6]
NP_001193969.1, NM_001207040.1 [Q9Y603-3]
NP_001193970.1, NM_001207041.1 [Q9Y603-8]
NP_057219.1, NM_016135.3 [Q9Y603-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000339796; ENSP00000342260; ENSG00000010030 [Q9Y603-5]
ENST00000340181; ENSP00000341843; ENSG00000010030 [Q9Y603-1]
ENST00000373737; ENSP00000362842; ENSG00000010030 [Q9Y603-7]
ENST00000373738; ENSP00000362843; ENSG00000010030 [Q9Y603-4]
ENST00000538992; ENSP00000440592; ENSG00000010030 [Q9Y603-8]
ENST00000615781; ENSP00000481885; ENSG00000010030 [Q9Y603-2]
ENST00000620358; ENSP00000484485; ENSG00000010030 [Q9Y603-3]
ENST00000627426; ENSP00000486712; ENSG00000010030 [Q9Y603-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51513

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51513

UCSC genome browser

More...
UCSCi
uc003olz.3 human [Q9Y603-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF116508 mRNA Translation: AAD43250.1
AF116509 mRNA Translation: AAD43251.1
AF116510 mRNA Translation: AAD43252.1
AF218235 mRNA Translation: AAF28350.1
AF218365 mRNA Translation: AAF44742.1
AF218366 mRNA Translation: AAF44743.1
AF175387 mRNA Translation: AAF25007.3
AF147782 mRNA Translation: AAD33989.1
AJ276205 mRNA Translation: CAC17012.1
AK122796 mRNA Translation: BAG53734.1
AK301011 mRNA Translation: BAG62628.1
AK303829 mRNA Translation: BAG64776.1
Z84484 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03885.1
CH471081 Genomic DNA Translation: EAX03888.1
CH471081 Genomic DNA Translation: EAX03890.1
BC035853 mRNA Translation: AAH35853.1
CCDSiCCDS4819.1 [Q9Y603-1]
CCDS56422.1 [Q9Y603-8]
CCDS56423.1 [Q9Y603-4]
CCDS56424.1 [Q9Y603-7]
CCDS56425.1 [Q9Y603-5]
CCDS75440.1 [Q9Y603-2]
CCDS75441.1 [Q9Y603-3]
CCDS78131.1 [Q9Y603-6]
RefSeqiNP_001193964.1, NM_001207035.1 [Q9Y603-5]
NP_001193965.1, NM_001207036.1 [Q9Y603-4]
NP_001193966.1, NM_001207037.1 [Q9Y603-2]
NP_001193967.1, NM_001207038.1 [Q9Y603-7]
NP_001193968.1, NM_001207039.1 [Q9Y603-6]
NP_001193969.1, NM_001207040.1 [Q9Y603-3]
NP_001193970.1, NM_001207041.1 [Q9Y603-8]
NP_057219.1, NM_016135.3 [Q9Y603-1]

3D structure databases

SMRiQ9Y603
ModBaseiSearch...

Protein-protein interaction databases

BioGridi119581, 7 interactors
IntActiQ9Y603, 6 interactors
MINTiQ9Y603
STRINGi9606.ENSP00000341843

PTM databases

iPTMnetiQ9Y603
PhosphoSitePlusiQ9Y603

Polymorphism and mutation databases

BioMutaiETV7
DMDMi13124589

Proteomic databases

MassIVEiQ9Y603
PaxDbiQ9Y603
PeptideAtlasiQ9Y603
PRIDEiQ9Y603
ProteomicsDBi5258
86561 [Q9Y603-1]
86562 [Q9Y603-2]
86563 [Q9Y603-3]
86564 [Q9Y603-4]
86565 [Q9Y603-5]
86566 [Q9Y603-6]
86567 [Q9Y603-7]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
51513

Genome annotation databases

EnsembliENST00000339796; ENSP00000342260; ENSG00000010030 [Q9Y603-5]
ENST00000340181; ENSP00000341843; ENSG00000010030 [Q9Y603-1]
ENST00000373737; ENSP00000362842; ENSG00000010030 [Q9Y603-7]
ENST00000373738; ENSP00000362843; ENSG00000010030 [Q9Y603-4]
ENST00000538992; ENSP00000440592; ENSG00000010030 [Q9Y603-8]
ENST00000615781; ENSP00000481885; ENSG00000010030 [Q9Y603-2]
ENST00000620358; ENSP00000484485; ENSG00000010030 [Q9Y603-3]
ENST00000627426; ENSP00000486712; ENSG00000010030 [Q9Y603-6]
GeneIDi51513
KEGGihsa:51513
UCSCiuc003olz.3 human [Q9Y603-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51513
DisGeNETi51513

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ETV7
HGNCiHGNC:18160 ETV7
HPAiHPA029033
HPA049689
MIMi605255 gene
neXtProtiNX_Q9Y603
OpenTargetsiENSG00000010030
PharmGKBiPA134980006

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3804 Eukaryota
ENOG4111K4J LUCA
GeneTreeiENSGT00940000162211
HOGENOMiHOG000012982
InParanoidiQ9Y603
KOiK03211
OMAiRIQPSLW
OrthoDBi827924at2759
PhylomeDBiQ9Y603
TreeFamiTF318679

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ETV7

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51513
PharosiQ9Y603

Protein Ontology

More...
PROi
PR:Q9Y603

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000010030 Expressed in 190 organ(s), highest expression level in buccal mucosa cell
GenevisibleiQ9Y603 HS

Family and domain databases

Gene3Di1.10.10.10, 1 hit
1.10.150.50, 1 hit
InterProiView protein in InterPro
IPR000418 Ets_dom
IPR003118 Pointed_dom
IPR013761 SAM/pointed_sf
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
PfamiView protein in Pfam
PF00178 Ets, 1 hit
PF02198 SAM_PNT, 1 hit
PRINTSiPR00454 ETSDOMAIN
SMARTiView protein in SMART
SM00413 ETS, 1 hit
SM00251 SAM_PNT, 1 hit
SUPFAMiSSF46785 SSF46785, 1 hit
SSF47769 SSF47769, 1 hit
PROSITEiView protein in PROSITE
PS00346 ETS_DOMAIN_2, 1 hit
PS50061 ETS_DOMAIN_3, 1 hit
PS51433 PNT, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiETV7_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y603
Secondary accession number(s): B3KVC2
, B4DVB6, B4E1G4, Q5R3L3, Q5R3L4, Q9NZ65, Q9NZ66, Q9NZ68, Q9NZR8, Q9UNJ7, Q9Y5K4, Q9Y604
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: November 1, 1999
Last modified: September 18, 2019
This is version 174 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again