Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcription factor ETV7

Gene

ETV7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Transcriptional repressor; binds to the DNA sequence 5'-CCGGAAGT-3'. Isoform A does not seem to have a repressor activity. Isoform C does not seem to have a repressor activity.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi224 – 305ETSPROSITE-ProRule annotationAdd BLAST82

GO - Molecular functioni

GO - Biological processi

  • animal organ morphogenesis Source: ProtInc
  • cell differentiation Source: GO_Central
  • negative regulation of transcription by RNA polymerase II Source: NTNU_SB
  • regulation of transcription by RNA polymerase II Source: GO_Central
  • transcription by RNA polymerase II Source: ProtInc

Keywordsi

Molecular functionDNA-binding, Repressor
Biological processTranscription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription factor ETV7
Alternative name(s):
ETS translocation variant 7
ETS-related protein Tel2
Tel-related Ets factor
Transcription factor Tel-2
Gene namesi
Name:ETV7
Synonyms:TEL2, TELB, TREF
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000010030.13
HGNCiHGNC:18160 ETV7
MIMi605255 gene
neXtProtiNX_Q9Y603

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi51513
OpenTargetsiENSG00000010030
PharmGKBiPA134980006

Polymorphism and mutation databases

BioMutaiETV7
DMDMi13124589

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002041231 – 341Transcription factor ETV7Add BLAST341

Proteomic databases

PaxDbiQ9Y603
PeptideAtlasiQ9Y603
PRIDEiQ9Y603
ProteomicsDBi86561
86562 [Q9Y603-2]
86563 [Q9Y603-3]
86564 [Q9Y603-4]
86565 [Q9Y603-5]
86566 [Q9Y603-6]
86567 [Q9Y603-7]

PTM databases

iPTMnetiQ9Y603
PhosphoSitePlusiQ9Y603

Expressioni

Tissue specificityi

Expressed in hematopoietic tissues.

Gene expression databases

BgeeiENSG00000010030 Expressed in 190 organ(s), highest expression level in buccal mucosa cell
GenevisibleiQ9Y603 HS

Organism-specific databases

HPAiHPA029033
HPA049689

Interactioni

Protein-protein interaction databases

BioGridi119581, 7 interactors
IntActiQ9Y603, 4 interactors
MINTiQ9Y603
STRINGi9606.ENSP00000341843

Structurei

3D structure databases

ProteinModelPortaliQ9Y603
SMRiQ9Y603
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini33 – 117PNTPROSITE-ProRule annotationAdd BLAST85

Sequence similaritiesi

Belongs to the ETS family.Curated

Phylogenomic databases

eggNOGiKOG3804 Eukaryota
ENOG4111K4J LUCA
GeneTreeiENSGT00760000118996
HOGENOMiHOG000012982
HOVERGENiHBG005617
InParanoidiQ9Y603
KOiK03211
OMAiRIQPSLW
OrthoDBiEOG091G05Q3
PhylomeDBiQ9Y603
TreeFamiTF318679

Family and domain databases

Gene3Di1.10.10.10, 1 hit
InterProiView protein in InterPro
IPR000418 Ets_dom
IPR003118 Pointed_dom
IPR013761 SAM/pointed_sf
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
PfamiView protein in Pfam
PF00178 Ets, 1 hit
PF02198 SAM_PNT, 1 hit
PRINTSiPR00454 ETSDOMAIN
SMARTiView protein in SMART
SM00413 ETS, 1 hit
SM00251 SAM_PNT, 1 hit
SUPFAMiSSF46785 SSF46785, 1 hit
SSF47769 SSF47769, 1 hit
PROSITEiView protein in PROSITE
PS00346 ETS_DOMAIN_2, 1 hit
PS50061 ETS_DOMAIN_3, 1 hit
PS51433 PNT, 1 hit

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform B (identifier: Q9Y603-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQEGELAISP ISPVAAMPPL GTHVQARCEA QINLLGEGGI CKLPGRLRIQ
60 70 80 90 100
PALWSREDVL HWLRWAEQEY SLPCTAEHGF EMNGRALCIL TKDDFRHRAP
110 120 130 140 150
SSGDVLYELL QYIKTQRRAL VCGPFFGGIF RLKTPTQHSP VPPEEVTGPS
160 170 180 190 200
QMDTRRGHLL QPPDPGLTSN FGHLDDPGLA RWTPGKEESL NLCHCAELGC
210 220 230 240 250
RTQGVCSFPA MPQAPIDGRI ADCRLLWDYV YQLLLDTRYE PYIKWEDKDA
260 270 280 290 300
KIFRVVDPNG LARLWGNHKN RVNMTYEKMS RALRHYYKLN IIKKEPGQKL
310 320 330 340
LFRFLKTPGK MVQDKHSHLE PLESQEQDRI EFKDKRPEIS P
Length:341
Mass (Da):38,998
Last modified:November 1, 1999 - v1
Checksum:i941983E83E45EBED
GO
Isoform A (identifier: Q9Y603-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-102: MQEGELAISP...DDFRHRAPSS → MHRGARVRDE...RTGFPLSGNP

Show »
Length:282
Mass (Da):32,435
Checksum:iD922B683DF411B25
GO
Isoform C (identifier: Q9Y603-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.

Show »
Length:260
Mass (Da):30,012
Checksum:i5D3EA756175F8081
GO
Isoform D (identifier: Q9Y603-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-103: Missing.

Show »
Length:286
Mass (Da):32,590
Checksum:i897E85CAEC7909EA
GO
Isoform E (identifier: Q9Y603-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-341: FLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP → NGLQLIFIFIWSFQ

Show »
Length:317
Mass (Da):36,205
Checksum:iE7275D5E5B94FAF0
GO
Isoform F (identifier: Q9Y603-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-103: Missing.
     304-341: FLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP → NGLQLIFIFIWSFQ

Show »
Length:262
Mass (Da):29,797
Checksum:i2DAAA51DD32252CB
GO
Isoform G (identifier: Q9Y603-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     145-221: Missing.

Show »
Length:264
Mass (Da):30,763
Checksum:iDB80D0C445B70646
GO
Isoform H (identifier: Q9Y603-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-151: Missing.

Show »
Length:190
Mass (Da):22,186
Checksum:iF7A5B7235BA599C3
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti27R → T in AAF25007 (PubMed:10828014).Curated1
Sequence conflicti255V → G in AAF25007 (PubMed:10828014).Curated1
Sequence conflicti273N → D in AAF25007 (PubMed:10828014).Curated1
Sequence conflicti311M → T in AAF25007 (PubMed:10828014).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05925786A → T. Corresponds to variant dbSNP:rs9394345Ensembl.1
Natural variantiVAR_048952138H → Y. Corresponds to variant dbSNP:rs9470262Ensembl.1
Natural variantiVAR_048953199G → S. Corresponds to variant dbSNP:rs34306145Ensembl.1
Natural variantiVAR_020314212P → L. Corresponds to variant dbSNP:rs2234079Ensembl.1
Natural variantiVAR_048954250A → V. Corresponds to variant dbSNP:rs2234080Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0442851 – 151Missing in isoform H. 1 PublicationAdd BLAST151
Alternative sequenceiVSP_0014731 – 102MQEGE…RAPSS → MHRGARVRDERTRPLHPHQG RLPAPCAQLRSGKRTGFPLS GNP in isoform A. 1 PublicationAdd BLAST102
Alternative sequenceiVSP_0014741 – 81Missing in isoform C. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_00147549 – 103Missing in isoform D and isoform F. 2 PublicationsAdd BLAST55
Alternative sequenceiVSP_001476145 – 221Missing in isoform G. 1 PublicationAdd BLAST77
Alternative sequenceiVSP_001477304 – 341FLKTP…PEISP → NGLQLIFIFIWSFQ in isoform E and isoform F. 1 PublicationAdd BLAST38

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF116508 mRNA Translation: AAD43250.1
AF116509 mRNA Translation: AAD43251.1
AF116510 mRNA Translation: AAD43252.1
AF218235 mRNA Translation: AAF28350.1
AF218365 mRNA Translation: AAF44742.1
AF218366 mRNA Translation: AAF44743.1
AF175387 mRNA Translation: AAF25007.3
AF147782 mRNA Translation: AAD33989.1
AJ276205 mRNA Translation: CAC17012.1
AK122796 mRNA Translation: BAG53734.1
AK301011 mRNA Translation: BAG62628.1
AK303829 mRNA Translation: BAG64776.1
Z84484 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03885.1
CH471081 Genomic DNA Translation: EAX03888.1
CH471081 Genomic DNA Translation: EAX03890.1
BC035853 mRNA Translation: AAH35853.1
CCDSiCCDS4819.1 [Q9Y603-1]
CCDS56422.1 [Q9Y603-8]
CCDS56423.1 [Q9Y603-4]
CCDS56424.1 [Q9Y603-7]
CCDS56425.1 [Q9Y603-5]
CCDS75440.1 [Q9Y603-2]
CCDS75441.1 [Q9Y603-3]
CCDS78131.1 [Q9Y603-6]
RefSeqiNP_001193964.1, NM_001207035.1 [Q9Y603-5]
NP_001193965.1, NM_001207036.1 [Q9Y603-4]
NP_001193966.1, NM_001207037.1 [Q9Y603-2]
NP_001193967.1, NM_001207038.1 [Q9Y603-7]
NP_001193968.1, NM_001207039.1 [Q9Y603-6]
NP_001193969.1, NM_001207040.1 [Q9Y603-3]
NP_001193970.1, NM_001207041.1 [Q9Y603-8]
NP_057219.1, NM_016135.3 [Q9Y603-1]
UniGeneiHs.272398

Genome annotation databases

EnsembliENST00000339796; ENSP00000342260; ENSG00000010030 [Q9Y603-5]
ENST00000340181; ENSP00000341843; ENSG00000010030 [Q9Y603-1]
ENST00000373737; ENSP00000362842; ENSG00000010030 [Q9Y603-7]
ENST00000373738; ENSP00000362843; ENSG00000010030 [Q9Y603-4]
ENST00000538992; ENSP00000440592; ENSG00000010030 [Q9Y603-8]
ENST00000615781; ENSP00000481885; ENSG00000010030 [Q9Y603-2]
ENST00000620358; ENSP00000484485; ENSG00000010030 [Q9Y603-3]
ENST00000627426; ENSP00000486712; ENSG00000010030 [Q9Y603-6]
GeneIDi51513
KEGGihsa:51513
UCSCiuc003olz.3 human [Q9Y603-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF116508 mRNA Translation: AAD43250.1
AF116509 mRNA Translation: AAD43251.1
AF116510 mRNA Translation: AAD43252.1
AF218235 mRNA Translation: AAF28350.1
AF218365 mRNA Translation: AAF44742.1
AF218366 mRNA Translation: AAF44743.1
AF175387 mRNA Translation: AAF25007.3
AF147782 mRNA Translation: AAD33989.1
AJ276205 mRNA Translation: CAC17012.1
AK122796 mRNA Translation: BAG53734.1
AK301011 mRNA Translation: BAG62628.1
AK303829 mRNA Translation: BAG64776.1
Z84484 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03885.1
CH471081 Genomic DNA Translation: EAX03888.1
CH471081 Genomic DNA Translation: EAX03890.1
BC035853 mRNA Translation: AAH35853.1
CCDSiCCDS4819.1 [Q9Y603-1]
CCDS56422.1 [Q9Y603-8]
CCDS56423.1 [Q9Y603-4]
CCDS56424.1 [Q9Y603-7]
CCDS56425.1 [Q9Y603-5]
CCDS75440.1 [Q9Y603-2]
CCDS75441.1 [Q9Y603-3]
CCDS78131.1 [Q9Y603-6]
RefSeqiNP_001193964.1, NM_001207035.1 [Q9Y603-5]
NP_001193965.1, NM_001207036.1 [Q9Y603-4]
NP_001193966.1, NM_001207037.1 [Q9Y603-2]
NP_001193967.1, NM_001207038.1 [Q9Y603-7]
NP_001193968.1, NM_001207039.1 [Q9Y603-6]
NP_001193969.1, NM_001207040.1 [Q9Y603-3]
NP_001193970.1, NM_001207041.1 [Q9Y603-8]
NP_057219.1, NM_016135.3 [Q9Y603-1]
UniGeneiHs.272398

3D structure databases

ProteinModelPortaliQ9Y603
SMRiQ9Y603
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119581, 7 interactors
IntActiQ9Y603, 4 interactors
MINTiQ9Y603
STRINGi9606.ENSP00000341843

PTM databases

iPTMnetiQ9Y603
PhosphoSitePlusiQ9Y603

Polymorphism and mutation databases

BioMutaiETV7
DMDMi13124589

Proteomic databases

PaxDbiQ9Y603
PeptideAtlasiQ9Y603
PRIDEiQ9Y603
ProteomicsDBi86561
86562 [Q9Y603-2]
86563 [Q9Y603-3]
86564 [Q9Y603-4]
86565 [Q9Y603-5]
86566 [Q9Y603-6]
86567 [Q9Y603-7]

Protocols and materials databases

DNASUi51513
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000339796; ENSP00000342260; ENSG00000010030 [Q9Y603-5]
ENST00000340181; ENSP00000341843; ENSG00000010030 [Q9Y603-1]
ENST00000373737; ENSP00000362842; ENSG00000010030 [Q9Y603-7]
ENST00000373738; ENSP00000362843; ENSG00000010030 [Q9Y603-4]
ENST00000538992; ENSP00000440592; ENSG00000010030 [Q9Y603-8]
ENST00000615781; ENSP00000481885; ENSG00000010030 [Q9Y603-2]
ENST00000620358; ENSP00000484485; ENSG00000010030 [Q9Y603-3]
ENST00000627426; ENSP00000486712; ENSG00000010030 [Q9Y603-6]
GeneIDi51513
KEGGihsa:51513
UCSCiuc003olz.3 human [Q9Y603-1]

Organism-specific databases

CTDi51513
DisGeNETi51513
EuPathDBiHostDB:ENSG00000010030.13
GeneCardsiETV7
HGNCiHGNC:18160 ETV7
HPAiHPA029033
HPA049689
MIMi605255 gene
neXtProtiNX_Q9Y603
OpenTargetsiENSG00000010030
PharmGKBiPA134980006
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3804 Eukaryota
ENOG4111K4J LUCA
GeneTreeiENSGT00760000118996
HOGENOMiHOG000012982
HOVERGENiHBG005617
InParanoidiQ9Y603
KOiK03211
OMAiRIQPSLW
OrthoDBiEOG091G05Q3
PhylomeDBiQ9Y603
TreeFamiTF318679

Miscellaneous databases

GeneWikiiETV7
GenomeRNAii51513
PROiPR:Q9Y603
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000010030 Expressed in 190 organ(s), highest expression level in buccal mucosa cell
GenevisibleiQ9Y603 HS

Family and domain databases

Gene3Di1.10.10.10, 1 hit
InterProiView protein in InterPro
IPR000418 Ets_dom
IPR003118 Pointed_dom
IPR013761 SAM/pointed_sf
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
PfamiView protein in Pfam
PF00178 Ets, 1 hit
PF02198 SAM_PNT, 1 hit
PRINTSiPR00454 ETSDOMAIN
SMARTiView protein in SMART
SM00413 ETS, 1 hit
SM00251 SAM_PNT, 1 hit
SUPFAMiSSF46785 SSF46785, 1 hit
SSF47769 SSF47769, 1 hit
PROSITEiView protein in PROSITE
PS00346 ETS_DOMAIN_2, 1 hit
PS50061 ETS_DOMAIN_3, 1 hit
PS51433 PNT, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiETV7_HUMAN
AccessioniPrimary (citable) accession number: Q9Y603
Secondary accession number(s): B3KVC2
, B4DVB6, B4E1G4, Q5R3L3, Q5R3L4, Q9NZ65, Q9NZ66, Q9NZ68, Q9NZR8, Q9UNJ7, Q9Y5K4, Q9Y604
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: November 1, 1999
Last modified: November 7, 2018
This is version 168 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again