Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9Y5X5 (NPFF2_HUMAN)

Entry version 165 (16 Oct 2019)
Sequence version 2 (27 Apr 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Neuropeptide FF receptor 2

Gene

NPFFR2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor for NPAF (A-18-F-amide) and NPFF (F-8-F-amide) neuropeptides, also known as morphine-modulating peptides. Can also be activated by a variety of naturally occurring or synthetic FMRF-amide like ligands. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-389397 Orexin and neuropeptides FF and QRFP bind to their respective receptors
R-HSA-416476 G alpha (q) signalling events

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q9Y5X5

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Neuropeptide FF receptor 2
Alternative name(s):
G-protein coupled receptor 74
G-protein coupled receptor HLWAR77
Neuropeptide G-protein coupled receptor
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NPFFR2
Synonyms:GPR74, NPFF2, NPGPR
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:4525 NPFFR2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		607449 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9Y5X5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 147ExtracellularSequence analysisAdd BLAST147
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei148 – 168Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini169 – 184CytoplasmicSequence analysisAdd BLAST16
Transmembranei185 – 205Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini206 – 221ExtracellularSequence analysisAdd BLAST16
Transmembranei222 – 242Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini243 – 262CytoplasmicSequence analysisAdd BLAST20
Transmembranei263 – 283Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini284 – 319ExtracellularSequence analysisAdd BLAST36
Transmembranei320 – 340Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini341 – 377CytoplasmicSequence analysisAdd BLAST37
Transmembranei378 – 398Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini399 – 413ExtracellularSequence analysisAdd BLAST15
Transmembranei414 – 434Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini435 – 522CytoplasmicSequence analysisAdd BLAST88

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		10886

Open Targets

More...OpenTargetsi		ENSG00000056291

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA28918

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9Y5X5

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL5952

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		301

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		NPFFR2

Domain mapping of disease mutations (DMDM)

More...DMDMi		13878604

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000699151 – 522Neuropeptide FF receptor 2Add BLAST522

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi110N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi122N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi133N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi220 ↔ 308PROSITE-ProRule annotation
Glycosylationi300N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9Y5X5

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9Y5X5

PeptideAtlas

More...PeptideAtlasi		Q9Y5X5

PRoteomics IDEntifications database

More...PRIDEi		Q9Y5X5

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		86531 [Q9Y5X5-1]
86532 [Q9Y5X5-2]
86533 [Q9Y5X5-3]
86534 [Q9Y5X5-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9Y5X5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9Y5X5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is abundant in placenta. Relatively highly expressed in thymus, testis, and small intestine. Expressed at low levels in several tissues including spleen, prostate, brain, heart, ovary, colon, kidney, lung, liver and pancreas and not expressed in skeletal muscle and leukocytes. Isoform 2 expression is highest in placenta (but at relatively low level compared to isoform 1). Very low level of expression in numerous tissues including adipose tissue and many brain regions. Isoform 3 is expressed in brain and heart and, at lower levels, in kidney, liver, lung and pancreas.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000056291 Expressed in 59 organ(s), highest expression level in chorionic villus

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9Y5X5 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9Y5X5 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA026825

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

Protein interaction database and analysis system

More...IntActi		Q9Y5X5, 1 interactor

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000307822

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q9Y5X5

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9Y5X5

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3656 Eukaryota
ENOG410XRW9 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00950000182743

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000041285

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9Y5X5

KEGG Orthology (KO)

More...KOi		K08375

Identification of Orthologs from Complete Genome Data

More...OMAi		YVDYYLH

Database of Orthologous Groups

More...OrthoDBi		856254at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9Y5X5

TreeFam database of animal gene trees

More...TreeFami		TF315303

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
IPR005395 NPFF_rcpt
IPR005397 NPFF_rcpt_2

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00001 7tm_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00237 GPCRRHODOPSN
PR01570 NPFFRECEPTOR
PR01572 NPFFRECEPTR2

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM01381 7TM_GPCR_Srsx, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Experimental confirmation may be lacking for some isoforms.
Isoform 1 (identifier: Q9Y5X5-1) [UniParc]FASTAAdd to basket
Also known as: long form

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNSFFGTPAA SWCLLESDVS SAPDKEAGRE RRALSVQQRG GPAWSGSLEW 
        60         70         80         90        100
SRQSAGDRRR LGLSRQTAKS SWSRSRDRTC CCRRAWWILV PAADRARRER 
       110        120        130        140        150
FIMNEKWDTN SSENWHPIWN VNDTKHHLYS DINITYVNYY LHQPQVAAIF 
       160        170        180        190        200
IISYFLIFFL CMMGNTVVCF IVMRNKHMHT VTNLFILNLA ISDLLVGIFC 
       210        220        230        240        250
MPITLLDNII AGWPFGNTMC KISGLVQGIS VAASVFTLVA IAVDRFQCVV 
       260        270        280        290        300
YPFKPKLTIK TAFVIIMIIW VLAITIMSPS AVMLHVQEEK YYRVRLNSQN 
       310        320        330        340        350
KTSPVYWCRE DWPNQEMRKI YTTVLFANIY LAPLSLIVIM YGRIGISLFR 
       360        370        380        390        400
AAVPHTGRKN QEQWHVVSRK KQKIIKMLLI VALLFILSWL PLWTLMMLSD 
       410        420        430        440        450
YADLSPNELQ IINIYIYPFA HWLAFGNSSV NPIIYGFFNE NFRRGFQEAF 
       460        470        480        490        500
QLQLCQKRAK PMEAYALKAK SHVLINTSNQ LVQESTFQNP HGETLLYRKS 
       510        520 
AEKPQQELVM EELKETTNSS EI
Length:522
Mass (Da):60,270
Last modified:April 27, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i40CB9FCD42F77041
GO
Isoform 2 (identifier: Q9Y5X5-2) [UniParc]FASTAAdd to basket
Also known as: short form

The sequence of this isoform differs from the canonical sequence as follows:
     1-102: Missing.

Show »
Length:420
Mass (Da):48,686
Checksum:i7A47C4CEEC1DBE07
GO
Isoform 3 (identifier: Q9Y5X5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-99: Missing.
     100-100: R → M

Show »
Length:423
Mass (Da):49,078
Checksum:i767946C4564A84F4
GO
Isoform 4 (identifier: Q9Y5X5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     101-132: FIMNEKWDTNSSENWHPIWNVNDTKHHLYSDI → MAIWKHDVQDQWIGPGNICRSFSLYVSCNCCR
     133-522: Missing.

Show »
Length:132
Mass (Da):15,055
Checksum:i0C561F6F086FC888
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAK58513 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti466A → T (PubMed:10079187).Curated1
Sequence conflicti466A → T (PubMed:10837915).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0019071 – 102Missing in isoform 2. 3 PublicationsAdd BLAST102
Alternative sequenceiVSP_0019081 – 99Missing in isoform 3. 1 PublicationAdd BLAST99
Alternative sequenceiVSP_001909100R → M in isoform 3. 1 Publication1
Alternative sequenceiVSP_001910101 – 132FIMNE…LYSDI → MAIWKHDVQDQWIGPGNICR SFSLYVSCNCCR in isoform 4. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_001911133 – 522Missing in isoform 4. 1 PublicationAdd BLAST390

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF119815 mRNA Translation: AAD22047.1
AF257210 mRNA Translation: AAF87078.1
AF268899 mRNA Translation: AAG41398.1
AF236083 mRNA Translation: AAK58513.1 Frameshift.
AF330053 mRNA Translation: AAK94197.1
AJ311393 mRNA Translation: CAC85427.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS3551.1 [Q9Y5X5-1]
CCDS3552.1 [Q9Y5X5-2]
CCDS47072.1 [Q9Y5X5-3]

NCBI Reference Sequences

More...RefSeqi		NP_001138228.1, NM_001144756.1 [Q9Y5X5-3]
NP_004876.2, NM_004885.2 [Q9Y5X5-1]
NP_444264.1, NM_053036.2 [Q9Y5X5-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000308744; ENSP00000307822; ENSG00000056291 [Q9Y5X5-1]
ENST00000344413; ENSP00000340789; ENSG00000056291 [Q9Y5X5-4]
ENST00000358749; ENSP00000351599; ENSG00000056291 [Q9Y5X5-2]
ENST00000395999; ENSP00000379321; ENSG00000056291 [Q9Y5X5-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		10886

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:10886

UCSC genome browser

More...UCSCi		uc003hgg.3 human [Q9Y5X5-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF119815 mRNA Translation: AAD22047.1
AF257210 mRNA Translation: AAF87078.1
AF268899 mRNA Translation: AAG41398.1
AF236083 mRNA Translation: AAK58513.1 Frameshift.
AF330053 mRNA Translation: AAK94197.1
AJ311393 mRNA Translation: CAC85427.1
CCDSiCCDS3551.1 [Q9Y5X5-1]
CCDS3552.1 [Q9Y5X5-2]
CCDS47072.1 [Q9Y5X5-3]
RefSeqiNP_001138228.1, NM_001144756.1 [Q9Y5X5-3]
NP_004876.2, NM_004885.2 [Q9Y5X5-1]
NP_444264.1, NM_053036.2 [Q9Y5X5-2]

3D structure databases

SMRiQ9Y5X5
ModBaseiSearch...

Protein-protein interaction databases

IntActiQ9Y5X5, 1 interactor
STRINGi9606.ENSP00000307822

Chemistry databases

BindingDBiQ9Y5X5
ChEMBLiCHEMBL5952
GuidetoPHARMACOLOGYi301

Protein family/group databases

Information system for G protein-coupled receptors (GPCRs)

More...GPCRDBi		Search...

PTM databases

iPTMnetiQ9Y5X5
PhosphoSitePlusiQ9Y5X5

Polymorphism and mutation databases

BioMutaiNPFFR2
DMDMi13878604

Proteomic databases

EPDiQ9Y5X5
PaxDbiQ9Y5X5
PeptideAtlasiQ9Y5X5
PRIDEiQ9Y5X5
ProteomicsDBi86531 [Q9Y5X5-1]
86532 [Q9Y5X5-2]
86533 [Q9Y5X5-3]
86534 [Q9Y5X5-4]

Genome annotation databases

EnsembliENST00000308744; ENSP00000307822; ENSG00000056291 [Q9Y5X5-1]
ENST00000344413; ENSP00000340789; ENSG00000056291 [Q9Y5X5-4]
ENST00000358749; ENSP00000351599; ENSG00000056291 [Q9Y5X5-2]
ENST00000395999; ENSP00000379321; ENSG00000056291 [Q9Y5X5-3]
GeneIDi10886
KEGGihsa:10886
UCSCiuc003hgg.3 human [Q9Y5X5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		10886
DisGeNETi10886

GeneCards: human genes, protein and diseases

More...GeneCardsi		NPFFR2
HGNCiHGNC:4525 NPFFR2
HPAiHPA026825
MIMi607449 gene
neXtProtiNX_Q9Y5X5
OpenTargetsiENSG00000056291
PharmGKBiPA28918

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3656 Eukaryota
ENOG410XRW9 LUCA
GeneTreeiENSGT00950000182743
HOGENOMiHOG000041285
InParanoidiQ9Y5X5
KOiK08375
OMAiYVDYYLH
OrthoDBi856254at2759
PhylomeDBiQ9Y5X5
TreeFamiTF315303

Enzyme and pathway databases

ReactomeiR-HSA-389397 Orexin and neuropeptides FF and QRFP bind to their respective receptors
R-HSA-416476 G alpha (q) signalling events
SIGNORiQ9Y5X5

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		NPFFR2 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		10886
PharosiQ9Y5X5

Protein Ontology

More...PROi		PR:Q9Y5X5

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000056291 Expressed in 59 organ(s), highest expression level in chorionic villus
ExpressionAtlasiQ9Y5X5 baseline and differential
GenevisibleiQ9Y5X5 HS

Family and domain databases

InterProiView protein in InterPro
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
IPR005395 NPFF_rcpt
IPR005397 NPFF_rcpt_2
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR00237 GPCRRHODOPSN
PR01570 NPFFRECEPTOR
PR01572 NPFFRECEPTR2
SMARTiView protein in SMART
SM01381 7TM_GPCR_Srsx, 1 hit
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNPFF2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y5X5
Secondary accession number(s): Q96RV1, Q9NR49
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: April 27, 2001
Last modified: October 16, 2019
This is version 165 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again