Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 188 (13 Nov 2019)
Sequence version 3 (26 Apr 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Melanoma-associated antigen D1

Gene

MAGED1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the apoptotic response after nerve growth factor (NGF) binding in neuronal cells. Inhibits cell cycle progression, and facilitates NGFR-mediated apoptosis. May act as a regulator of the function of DLX family members. May enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex. Plays a role in the circadian rhythm regulation. May act as RORA co-regulator, modulating the expression of core clock genes such as ARNTL/BMAL1 and NFIL3, induced, or NR1D1, repressed.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTumor antigen
Biological processBiological rhythms, Ubl conjugation pathway

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-193648 NRAGE signals death through JNK
R-HSA-418889 Caspase activation via Dependence Receptors in the absence of ligand

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9Y5V3

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9Y5V3

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Melanoma-associated antigen D1
Alternative name(s):
MAGE tumor antigen CCF
MAGE-D1 antigen
Neurotrophin receptor-interacting MAGE homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MAGED1
Synonyms:NRAGE
ORF Names:PP2250, PRO2292
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6813 MAGED1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300224 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y5V3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9500

Open Targets

More...
OpenTargetsi
ENSG00000179222

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30559

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9Y5V3

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MAGED1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
62906893

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001567231 – 778Melanoma-associated antigen D1Add BLAST778

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei92PhosphotyrosineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9Y5V3

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9Y5V3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9Y5V3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y5V3

PeptideAtlas

More...
PeptideAtlasi
Q9Y5V3

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y5V3

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
86514 [Q9Y5V3-1]
86515 [Q9Y5V3-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y5V3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y5V3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in bone marrow stromal cells from both multiple myeloma patients and healthy donors. Seems to be ubiquitously expressed.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000179222 Expressed in 233 organ(s), highest expression level in pituitary gland

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Y5V3 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA043645

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with DLX5, DLX7 and MSX2 and forms homomultimers.

Interacts with UNC5A.

Interacts with TRIM28 and PJA1.

Interacts with NGFR/p75NTR and RORA.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114879, 143 interactors

Protein interaction database and analysis system

More...
IntActi
Q9Y5V3, 150 interactors

Molecular INTeraction database

More...
MINTi
Q9Y5V3

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000364847

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Y5V3

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati296 – 30116
Repeati302 – 30726
Repeati308 – 31336
Repeati332 – 33746
Repeati338 – 34356
Repeati344 – 34966
Repeati350 – 35576
Repeati356 – 36186
Repeati362 – 36796
Repeati368 – 373106
Repeati374 – 379116
Repeati380 – 385126
Repeati386 – 391136
Repeati392 – 397146
Repeati398 – 403156
Repeati404 – 409166
Repeati410 – 415176
Repeati416 – 421186
Repeati422 – 427196
Repeati428 – 43220; approximate5
Repeati433 – 438216
Repeati439 – 444226
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini471 – 669MAGEPROSITE-ProRule annotationAdd BLAST199

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni296 – 44422 X 6 AA tandem repeats of W-[PQ]-X-P-X-XAdd BLAST149

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi279 – 452Pro-richAdd BLAST174

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4562 Eukaryota
ENOG4111S70 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162070

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y5V3

KEGG Orthology (KO)

More...
KOi
K12464

Identification of Orthologs from Complete Genome Data

More...
OMAi
AVCHPLP

Database of Orthologous Groups

More...
OrthoDBi
1195799at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y5V3

TreeFam database of animal gene trees

More...
TreeFami
TF352132

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.10.1200, 1 hit
1.10.10.1210, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR037445 MAGE
IPR041898 MAGE_WH1
IPR041899 MAGE_WH2
IPR030083 MAGED1
IPR002190 MHD_dom

The PANTHER Classification System

More...
PANTHERi
PTHR11736 PTHR11736, 1 hit
PTHR11736:SF28 PTHR11736:SF28, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01454 MAGE, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01373 MAGE, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50838 MAGE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9Y5V3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAQKMDCGAG LLGFQAEASV EDSALLMQTL MEAIQISEAP PTNQATAAAS
60 70 80 90 100
PQSSQPPTAN EMADIQVSAA AARPKSAFKV QNATTKGPNG VYDFSQAHNA
110 120 130 140 150
KDVPNTQPKA AFKSQNATPK GPNAAYDFSQ AATTGELAAN KSEMAFKAQN
160 170 180 190 200
ATTKVGPNAT YNFSQSLNAN DLANSRPKTP FKAWNDTTKA PTADTQTQNV
210 220 230 240 250
NQAKMATSQA DIETDPGISE PDGATAQTSA DGSQAQNLES RTIIRGKRTR
260 270 280 290 300
KINNLNVEEN SSGDQRRAPL AAGTWRSAPV PVTTQNPPGA PPNVLWQTPL
310 320 330 340 350
AWQNPSGWQN QTARQTPPAR QSPPARQTPP AWQNPVAWQN PVIWPNPVIW
360 370 380 390 400
QNPVIWPNPI VWPGPVVWPN PLAWQNPPGW QTPPGWQTPP GWQGPPDWQG
410 420 430 440 450
PPDWPLPPDW PLPPDWPLPT DWPLPPDWIP ADWPIPPDWQ NLRPSPNLRP
460 470 480 490 500
SPNSRASQNP GAAQPRDVAL LQERANKLVK YLMLKDYTKV PIKRSEMLRD
510 520 530 540 550
IIREYTDVYP EIIERACFVL EKKFGIQLKE IDKEEHLYIL ISTPESLAGI
560 570 580 590 600
LGTTKDTPKL GLLLVILGVI FMNGNRASEA VLWEALRKMG LRPGVRHPLL
610 620 630 640 650
GDLRKLLTYE FVKQKYLDYR RVPNSNPPEY EFLWGLRSYH ETSKMKVLRF
660 670 680 690 700
IAEVQKRDPR DWTAQFMEAA DEALDALDAA AAEAEARAEA RTRMGIGDEA
710 720 730 740 750
VSGPWSWDDI EFELLTWDEE GDFGDPWSRI PFTFWARYHQ NARSRFPQTF
760 770
AGPIIGPGGT ASANFAANFG AIGFFWVE
Length:778
Mass (Da):86,161
Last modified:April 26, 2005 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD818690052D166CE
GO
Isoform 2 (identifier: Q9Y5V3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     15-15: Q → QNPDACRAVCHPLPQPPASTLPLSAFPTLCDPPYSQLRDPPAVLSCYCTPLGASPAP

Note: No experimental confirmation available.
Show »
Length:834
Mass (Da):91,959
Checksum:iCD8E13CE9B35EA7C
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD31421 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAG35551 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti119P → S in AAG09704 (PubMed:10985348).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_060070238L → M. Corresponds to variant dbSNP:rs12689461Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00928615Q → QNPDACRAVCHPLPQPPAST LPLSAFPTLCDPPYSQLRDP PAVLSCYCTPLGASPAP in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF217963 mRNA Translation: AAG09704.1
AF258554 mRNA Translation: AAG23757.1
AF300328 mRNA Translation: AAQ14483.1
AL929410 Genomic DNA No translation available.
BC014070 mRNA Translation: AAH14070.1
BC032473 mRNA Translation: AAH32473.1
AF124440 mRNA Translation: AAD31421.1 Different initiation.
AL133628 mRNA Translation: CAB63752.1
AF132205 mRNA Translation: AAG35551.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14337.1 [Q9Y5V3-1]
CCDS35279.1 [Q9Y5V3-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
T43464

NCBI Reference Sequences

More...
RefSeqi
NP_001005332.1, NM_001005332.1 [Q9Y5V3-1]
NP_001005333.1, NM_001005333.1 [Q9Y5V3-2]
NP_008917.3, NM_006986.3 [Q9Y5V3-1]
XP_011529137.1, XM_011530835.2 [Q9Y5V3-1]
XP_016885467.1, XM_017029978.1 [Q9Y5V3-1]
XP_016885468.1, XM_017029979.1 [Q9Y5V3-1]
XP_016885469.1, XM_017029980.1 [Q9Y5V3-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000326587; ENSP00000325333; ENSG00000179222 [Q9Y5V3-1]
ENST00000375695; ENSP00000364847; ENSG00000179222 [Q9Y5V3-2]
ENST00000375722; ENSP00000364874; ENSG00000179222 [Q9Y5V3-1]
ENST00000375772; ENSP00000364927; ENSG00000179222 [Q9Y5V3-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9500

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9500

UCSC genome browser

More...
UCSCi
uc004dpm.5 human [Q9Y5V3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF217963 mRNA Translation: AAG09704.1
AF258554 mRNA Translation: AAG23757.1
AF300328 mRNA Translation: AAQ14483.1
AL929410 Genomic DNA No translation available.
BC014070 mRNA Translation: AAH14070.1
BC032473 mRNA Translation: AAH32473.1
AF124440 mRNA Translation: AAD31421.1 Different initiation.
AL133628 mRNA Translation: CAB63752.1
AF132205 mRNA Translation: AAG35551.1 Different initiation.
CCDSiCCDS14337.1 [Q9Y5V3-1]
CCDS35279.1 [Q9Y5V3-2]
PIRiT43464
RefSeqiNP_001005332.1, NM_001005332.1 [Q9Y5V3-1]
NP_001005333.1, NM_001005333.1 [Q9Y5V3-2]
NP_008917.3, NM_006986.3 [Q9Y5V3-1]
XP_011529137.1, XM_011530835.2 [Q9Y5V3-1]
XP_016885467.1, XM_017029978.1 [Q9Y5V3-1]
XP_016885468.1, XM_017029979.1 [Q9Y5V3-1]
XP_016885469.1, XM_017029980.1 [Q9Y5V3-1]

3D structure databases

SMRiQ9Y5V3
ModBaseiSearch...

Protein-protein interaction databases

BioGridi114879, 143 interactors
IntActiQ9Y5V3, 150 interactors
MINTiQ9Y5V3
STRINGi9606.ENSP00000364847

PTM databases

iPTMnetiQ9Y5V3
PhosphoSitePlusiQ9Y5V3

Polymorphism and mutation databases

BioMutaiMAGED1
DMDMi62906893

Proteomic databases

EPDiQ9Y5V3
jPOSTiQ9Y5V3
MassIVEiQ9Y5V3
PaxDbiQ9Y5V3
PeptideAtlasiQ9Y5V3
PRIDEiQ9Y5V3
ProteomicsDBi86514 [Q9Y5V3-1]
86515 [Q9Y5V3-2]

Genome annotation databases

EnsembliENST00000326587; ENSP00000325333; ENSG00000179222 [Q9Y5V3-1]
ENST00000375695; ENSP00000364847; ENSG00000179222 [Q9Y5V3-2]
ENST00000375722; ENSP00000364874; ENSG00000179222 [Q9Y5V3-1]
ENST00000375772; ENSP00000364927; ENSG00000179222 [Q9Y5V3-1]
GeneIDi9500
KEGGihsa:9500
UCSCiuc004dpm.5 human [Q9Y5V3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9500
DisGeNETi9500

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MAGED1
HGNCiHGNC:6813 MAGED1
HPAiHPA043645
MIMi300224 gene
neXtProtiNX_Q9Y5V3
OpenTargetsiENSG00000179222
PharmGKBiPA30559

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4562 Eukaryota
ENOG4111S70 LUCA
GeneTreeiENSGT00940000162070
InParanoidiQ9Y5V3
KOiK12464
OMAiAVCHPLP
OrthoDBi1195799at2759
PhylomeDBiQ9Y5V3
TreeFamiTF352132

Enzyme and pathway databases

ReactomeiR-HSA-193648 NRAGE signals death through JNK
R-HSA-418889 Caspase activation via Dependence Receptors in the absence of ligand
SignaLinkiQ9Y5V3
SIGNORiQ9Y5V3

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MAGED1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
MAGED1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9500
PharosiQ9Y5V3

Protein Ontology

More...
PROi
PR:Q9Y5V3

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000179222 Expressed in 233 organ(s), highest expression level in pituitary gland
GenevisibleiQ9Y5V3 HS

Family and domain databases

Gene3Di1.10.10.1200, 1 hit
1.10.10.1210, 1 hit
InterProiView protein in InterPro
IPR037445 MAGE
IPR041898 MAGE_WH1
IPR041899 MAGE_WH2
IPR030083 MAGED1
IPR002190 MHD_dom
PANTHERiPTHR11736 PTHR11736, 1 hit
PTHR11736:SF28 PTHR11736:SF28, 1 hit
PfamiView protein in Pfam
PF01454 MAGE, 1 hit
SMARTiView protein in SMART
SM01373 MAGE, 1 hit
PROSITEiView protein in PROSITE
PS50838 MAGE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMAGD1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y5V3
Secondary accession number(s): Q5VSH6
, Q8IZ84, Q8WY92, Q9H352, Q9HBT4, Q9UF36
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 24, 2001
Last sequence update: April 26, 2005
Last modified: November 13, 2019
This is version 188 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again