Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NADPH oxidase 1

Gene

NOX1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

NOH-1S is a voltage-gated proton channel that mediates the H+ currents of resting phagocytes and other tissues. It participates in the regulation of cellular pH and is blocked by zinc. NOH-1L is a pyridine nucleotide-dependent oxidoreductase that generates superoxide and might conduct H+ ions as part of its electron transport mechanism, whereas NOH-1S does not contain an electron transport chain.

Cofactori

Protein has several cofactor binding sites:

Enzyme regulationi

The oxidase activity is potentiated by NOXA1 and NOXO1.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi101Iron (heme axial ligand)Curated1
Metal bindingi115Iron (heme axial ligand)Curated1
Metal bindingi209Iron (heme axial ligand)Curated1
Metal bindingi221Iron (heme axial ligand)Curated1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi338 – 344FADSequence analysis7

GO - Molecular functioni

  • metal ion binding Source: UniProtKB-KW
  • NADP binding Source: BHF-UCL
  • Rac GTPase binding Source: BHF-UCL
  • superoxide-generating NADPH oxidase activity Source: BHF-UCL
  • voltage-gated ion channel activity Source: UniProtKB-KW

GO - Biological processi

  • angiogenesis Source: BHF-UCL
  • cell migration Source: BHF-UCL
  • cellular response to hyperoxia Source: Ensembl
  • cellular stress response to acidic pH Source: BHF-UCL
  • extracellular matrix organization Source: Ensembl
  • hydrogen peroxide metabolic process Source: BHF-UCL
  • inflammatory response Source: BHF-UCL
  • intracellular pH elevation Source: BHF-UCL
  • NADP metabolic process Source: BHF-UCL
  • oxidation-reduction process Source: BHF-UCL
  • oxygen metabolic process Source: Ensembl
  • positive regulation of cell proliferation Source: BHF-UCL
  • positive regulation of integrin biosynthetic process Source: BHF-UCL
  • positive regulation of JNK cascade Source: Ensembl
  • positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway Source: Ensembl
  • positive regulation of smooth muscle cell proliferation Source: BHF-UCL
  • positive regulation of vascular endothelial growth factor production Source: BHF-UCL
  • regulation of blood pressure Source: BHF-UCL
  • regulation of ion transmembrane transport Source: UniProtKB-KW
  • regulation of systemic arterial blood pressure by renin-angiotensin Source: Ensembl
  • respiratory burst Source: BHF-UCL
  • signal transduction Source: BHF-UCL
  • superoxide anion generation Source: BHF-UCL

Keywordsi

Molecular functionIon channel, Oxidoreductase, Voltage-gated channel
Biological processElectron transport, Ion transport, Transport
LigandFAD, Flavoprotein, Heme, Iron, Metal-binding, NADP

Enzyme and pathway databases

ReactomeiR-HSA-5668599 RHO GTPases Activate NADPH Oxidases

Protein family/group databases

PeroxiBasei5410 HsNOx01
TCDBi5.B.1.1.3 the phagocyte (gp91(phox)) nadph oxidase family

Names & Taxonomyi

Protein namesi
Recommended name:
NADPH oxidase 1 (EC:1.-.-.-)
Short name:
NOX-1
Alternative name(s):
Mitogenic oxidase 1
Short name:
MOX-1
NADH/NADPH mitogenic oxidase subunit P65-MOX
NOH-1
Gene namesi
Name:NOX1
Synonyms:MOX1, NOH1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000007952.17
HGNCiHGNC:7889 NOX1
MIMi300225 gene
neXtProtiNX_Q9Y5S8

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 9CytoplasmicSequence analysis9
Transmembranei10 – 30HelicalSequence analysisAdd BLAST21
Topological domaini31 – 44ExtracellularSequence analysisAdd BLAST14
Transmembranei45 – 72HelicalSequence analysisAdd BLAST28
Topological domaini73 – 102CytoplasmicSequence analysisAdd BLAST30
Transmembranei103 – 123HelicalSequence analysisAdd BLAST21
Topological domaini124 – 168ExtracellularSequence analysisAdd BLAST45
Transmembranei169 – 189HelicalSequence analysisAdd BLAST21
Topological domaini190 – 206CytoplasmicSequence analysisAdd BLAST17
Transmembranei207 – 227HelicalSequence analysisAdd BLAST21
Topological domaini228 – 396ExtracellularSequence analysisAdd BLAST169
Transmembranei397 – 417HelicalSequence analysisAdd BLAST21
Topological domaini418 – 564CytoplasmicSequence analysisAdd BLAST147

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane

Pathology & Biotechi

Involvement in diseasei

Defects in NOX1 may play a role in the pathogenesis of very early onset inflammatory bowel disease (VEOIBD), a chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology diagnosed before 6 years of age. VEOIBD is subdivided into Crohn disease and ulcerative colitis phenotypes. Crohn disease may affect any part of the gastrointestinal tract from the mouth to the anus, but the phenotype of children with onset of Crohn disease occurring younger than the age of 10 is predominantly colonic, with a lower risk of ileal disease. Bowel inflammation is transmural and discontinuous; it may contain granulomas or be associated with intestinal or perianal fistulas. In contrast, in ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers; fistulas and granulomas are not observed. Both diseases include extraintestinal inflammation of the skin, eyes, or joints.1 Publication

Organism-specific databases

DisGeNETi27035
OpenTargetsiENSG00000007952
PharmGKBiPA31690

Chemistry databases

ChEMBLiCHEMBL1287628
GuidetoPHARMACOLOGYi3001

Polymorphism and mutation databases

BioMutaiNOX1
DMDMi8134597

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002101481 – 564NADPH oxidase 1Add BLAST564

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi162N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi236N-linked (GlcNAc...) asparagine1 Publication1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9Y5S8
PeptideAtlasiQ9Y5S8
PRIDEiQ9Y5S8
ProteomicsDBi86491
86492 [Q9Y5S8-2]
86493 [Q9Y5S8-3]

PTM databases

iPTMnetiQ9Y5S8
PhosphoSitePlusiQ9Y5S8

Expressioni

Tissue specificityi

NOH-1L is detected in colon, uterus, prostate, and colon carcinoma, but not in peripheral blood leukocytes. NOH-1S is detected only in colon and colon carcinoma cells.

Gene expression databases

BgeeiENSG00000007952
CleanExiHS_NOX1
ExpressionAtlasiQ9Y5S8 baseline and differential
GenevisibleiQ9Y5S8 HS

Interactioni

Subunit structurei

NOX1, NOXA1, NOXO1, RAC1 and CYBA forms a functional multimeric complex supporting reactive oxygen species (ROS) production. Interacts with NOXA1 and NOXO1.2 Publications

GO - Molecular functioni

  • Rac GTPase binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi117966, 4 interactors
DIPiDIP-60457N
IntActiQ9Y5S8, 2 interactors
STRINGi9606.ENSP00000362057

Chemistry databases

BindingDBiQ9Y5S8

Structurei

3D structure databases

ProteinModelPortaliQ9Y5S8
SMRiQ9Y5S8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini54 – 283Ferric oxidoreductaseAdd BLAST230
Domaini284 – 391FAD-binding FR-typePROSITE-ProRule annotationAdd BLAST108

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni397 – 536Interaction with NOXO11 PublicationAdd BLAST140

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0039 Eukaryota
ENOG410XNZY LUCA
GeneTreeiENSGT00550000074350
HOGENOMiHOG000216669
HOVERGENiHBG003760
InParanoidiQ9Y5S8
KOiK08008
OMAiIHIRAAG
OrthoDBiEOG091G09RV
PhylomeDBiQ9Y5S8
TreeFamiTF105354

Family and domain databases

Gene3Di3.40.50.80, 1 hit
InterProiView protein in InterPro
IPR000778 Cyt_b245_heavy_chain
IPR013112 FAD-bd_8
IPR017927 Fd_Rdtase_FAD-bd
IPR013130 Fe3_Rdtase_TM_dom
IPR013121 Fe_red_NAD-bd_6
IPR039261 FNR_nucleotide_bd
IPR029650 NOX1
IPR017938 Riboflavin_synthase-like_b-brl
PANTHERiPTHR11972:SF71 PTHR11972:SF71, 1 hit
PfamiView protein in Pfam
PF08022 FAD_binding_8, 1 hit
PF01794 Ferric_reduct, 1 hit
PF08030 NAD_binding_6, 1 hit
PRINTSiPR00466 GP91PHOX
SUPFAMiSSF52343 SSF52343, 1 hit
SSF63380 SSF63380, 1 hit
PROSITEiView protein in PROSITE
PS51384 FAD_FR, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform NOH-1L (identifier: Q9Y5S8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGNWVVNHWF SVLFLVVWLG LNVFLFVDAF LKYEKADKYY YTRKILGSTL
60 70 80 90 100
ACARASALCL NFNSTLILLP VCRNLLSFLR GTCSFCSRTL RKQLDHNLTF
110 120 130 140 150
HKLVAYMICL HTAIHIIAHL FNFDCYSRSR QATDGSLASI LSSLSHDEKK
160 170 180 190 200
GGSWLNPIQS RNTTVEYVTF TSIAGLTGVI MTIALILMVT SATEFIRRSY
210 220 230 240 250
FEVFWYTHHL FIFYILGLGI HGIGGIVRGQ TEESMNESHP RKCAESFEMW
260 270 280 290 300
DDRDSHCRRP KFEGHPPESW KWILAPVILY ICERILRFYR SQQKVVITKV
310 320 330 340 350
VMHPSKVLEL QMNKRGFSME VGQYIFVNCP SISLLEWHPF TLTSAPEEDF
360 370 380 390 400
FSIHIRAAGD WTENLIRAFE QQYSPIPRIE VDGPFGTASE DVFQYEVAVL
410 420 430 440 450
VGAGIGVTPF ASILKSIWYK FQCADHNLKT KKIYFYWICR ETGAFSWFNN
460 470 480 490 500
LLTSLEQEME ELGKVGFLNY RLFLTGWDSN IVGHAALNFD KATDIVTGLK
510 520 530 540 550
QKTSFGRPMW DNEFSTIATS HPKSVVGVFL CGPRTLAKSL RKCCHRYSSL
560
DPRKVQFYFN KENF
Length:564
Mass (Da):64,871
Last modified:May 1, 2000 - v2
Checksum:iC3BE290F4E6DBC9A
GO
Isoform NOH-1S (identifier: Q9Y5S8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     159-190: QSRNTTVEYVTFTSIAGLTGVIMTIALILMVT → HPHITPTVYMFTVTFDMVLSSVNSNLLFLLIK
     191-564: Missing.

Show »
Length:190
Mass (Da):21,704
Checksum:i75C0B809E9AE8E3D
GO
Isoform NOH-1LV (identifier: Q9Y5S8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     433-481: Missing.

Show »
Length:515
Mass (Da):58,972
Checksum:i1D79577159D69688
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti173I → V in AAD38133 (PubMed:10615049).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_049101315R → H. Corresponds to variant dbSNP:rs2071756Ensembl.1
Natural variantiVAR_075548330P → S Found in a patient with very early onset inflammatory bowel disease; unknown pathological significance; no effect on subcellular location; significantly reduced basal and phorbol ester-stimulated ROS generation, which may decrease resistance to infection by enteric pathogens, such as Campylobacter jejuni. 1 Publication1
Natural variantiVAR_061176360D → N Found in a patient with very early onset inflammatory bowel disease; unknown pathological significance; no effect on subcellular location; significantly reduced basal and phorbol ester-stimulated ROS generation, which may decrease resistance to infection by enteric pathogens, such as Campylobacter jejuni. 1 PublicationCorresponds to variant dbSNP:rs34688635Ensembl.1
Natural variantiVAR_049102378R → K. Corresponds to variant dbSNP:rs35404864Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_001577159 – 190QSRNT…ILMVT → HPHITPTVYMFTVTFDMVLS SVNSNLLFLLIK in isoform NOH-1S. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_001578191 – 564Missing in isoform NOH-1S. 1 PublicationAdd BLAST374
Alternative sequenceiVSP_001579433 – 481Missing in isoform NOH-1LV. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF127763 mRNA Translation: AAD38133.1
AF166326 mRNA Translation: AAF23232.1
AF166327 mRNA Translation: AAF23233.1
AF166328 mRNA Translation: AAF23234.1
DQ314883 Genomic DNA Translation: ABC40742.1
AK292201 mRNA Translation: BAF84890.1
Z83819 Genomic DNA No translation available.
CH471115 Genomic DNA Translation: EAX02820.1
BC075014 mRNA Translation: AAH75014.1
BC075015 mRNA Translation: AAH75015.1
CCDSiCCDS14474.1 [Q9Y5S8-1]
CCDS14475.1 [Q9Y5S8-3]
RefSeqiNP_001258744.1, NM_001271815.1
NP_008983.2, NM_007052.4 [Q9Y5S8-1]
NP_039249.1, NM_013955.2 [Q9Y5S8-3]
UniGeneiHs.592227

Genome annotation databases

EnsembliENST00000217885; ENSP00000217885; ENSG00000007952 [Q9Y5S8-3]
ENST00000372966; ENSP00000362057; ENSG00000007952 [Q9Y5S8-1]
GeneIDi27035
KEGGihsa:27035
UCSCiuc004egj.3 human [Q9Y5S8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiNOX1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y5S8
Secondary accession number(s): A8K836, O95691, Q2PP02
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 1, 2000
Last modified: July 18, 2018
This is version 163 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health