Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website on Tuesday, June 28. Please explore and share your feedback. Take me to UniProt BETA

UniProtKB - Q9Y5S8 (NOX1_HUMAN)

Entry version 187 (25 May 2022)
Sequence version 2 (01 May 2000)
Previous versions | rss
Add a publicationFeedback
Protein

NADPH oxidase 1

Gene

NOX1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

NOH-1S is a voltage-gated proton channel that mediates the H+ currents of resting phagocytes and other tissues. It participates in the regulation of cellular pH and is blocked by zinc. NOH-1L is a pyridine nucleotide-dependent oxidoreductase that generates superoxide and might conduct H+ ions as part of its electron transport mechanism, whereas NOH-1S does not contain an electron transport chain.

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Protein has several cofactor binding sites:

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

The oxidase activity is potentiated by NOXA1 and NOXO1.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi101Iron (heme axial ligand)Curated1
Metal bindingi115Iron (heme axial ligand)Curated1
Metal bindingi209Iron (heme axial ligand)Curated1
Metal bindingi221Iron (heme axial ligand)Curated1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi338 – 344FADSequence analysis7

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel, Oxidoreductase, Voltage-gated channel
Biological processElectron transport, Ion transport, Transport
LigandFAD, Flavoprotein, Heme, Iron, Metal-binding, NADP

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9Y5S8

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-5668599, RHO GTPases Activate NADPH Oxidases
R-HSA-9013149, RAC1 GTPase cycle
R-HSA-9013423, RAC3 GTPase cycle
R-HSA-9673324, WNT5:FZD7-mediated leishmania damping

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q9Y5S8

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q9Y5S8

Protein family/group databases

PeroxiBase, a peroxidase database

More...PeroxiBasei		5410, HsNOx01

Transport Classification Database

More...TCDBi		5.B.1.1.3, the phagocyte (gp91(phox)) nadph oxidase family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
NADPH oxidase 1 (EC:1.-.-.-)
Short name:
NOX-1
Alternative name(s):
Mitogenic oxidase 1
Short name:
MOX-1
NADH/NADPH mitogenic oxidase subunit P65-MOX
NOH-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NOX1
Synonyms:MOX1, NOH1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:7889, NOX1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		300225, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9Y5S8

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000007952

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 9CytoplasmicSequence analysis9
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei10 – 30HelicalSequence analysisAdd BLAST21
Topological domaini31 – 44ExtracellularSequence analysisAdd BLAST14
Transmembranei45 – 72HelicalSequence analysisAdd BLAST28
Topological domaini73 – 102CytoplasmicSequence analysisAdd BLAST30
Transmembranei103 – 123HelicalSequence analysisAdd BLAST21
Topological domaini124 – 168ExtracellularSequence analysisAdd BLAST45
Transmembranei169 – 189HelicalSequence analysisAdd BLAST21
Topological domaini190 – 206CytoplasmicSequence analysisAdd BLAST17
Transmembranei207 – 227HelicalSequence analysisAdd BLAST21
Topological domaini228 – 396ExtracellularSequence analysisAdd BLAST169
Transmembranei397 – 417HelicalSequence analysisAdd BLAST21
Topological domaini418 – 564CytoplasmicSequence analysisAdd BLAST147

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Defects in NOX1 may play a role in the pathogenesis of very early onset inflammatory bowel disease (VEOIBD), a chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology diagnosed before 6 years of age. VEOIBD is subdivided into Crohn disease and ulcerative colitis phenotypes. Crohn disease may affect any part of the gastrointestinal tract from the mouth to the anus, but the phenotype of children with onset of Crohn disease occurring younger than the age of 10 is predominantly colonic, with a lower risk of ileal disease. Bowel inflammation is transmural and discontinuous; it may contain granulomas or be associated with intestinal or perianal fistulas. In contrast, in ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers; fistulas and granulomas are not observed. Both diseases include extraintestinal inflammation of the skin, eyes, or joints.1 Publication

Organism-specific databases

DisGeNET

More...DisGeNETi		27035

Open Targets

More...OpenTargetsi		ENSG00000007952

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA31690

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9Y5S8, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL1287628

Drug and drug target database

More...DrugBanki		DB09140, Oxygen

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		3001

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		NOX1

Domain mapping of disease mutations (DMDM)

More...DMDMi		8134597

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002101481 – 564NADPH oxidase 1Add BLAST564

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi162N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi236N-linked (GlcNAc...) asparagine1 Publication1

Keywords - PTMi

Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9Y5S8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9Y5S8

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9Y5S8

PeptideAtlas

More...PeptideAtlasi		Q9Y5S8

PRoteomics IDEntifications database

More...PRIDEi		Q9Y5S8

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		86491 [Q9Y5S8-1]
86492 [Q9Y5S8-2]
86493 [Q9Y5S8-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q9Y5S8, 2 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9Y5S8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9Y5S8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

NOH-1L is detected in colon, uterus, prostate, and colon carcinoma, but not in peripheral blood leukocytes. NOH-1S is detected only in colon and colon carcinoma cells.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000007952, Expressed in colonic mucosa and 141 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9Y5S8, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9Y5S8, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000007952, Tissue enriched (intestine)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

NOX1, NOXA1, NOXO1, RAC1 and CYBA forms a functional multimeric complex supporting reactive oxygen species (ROS) production.

Interacts with NOXA1 and NOXO1.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		117966, 11 interactors

Database of interacting proteins

More...DIPi		DIP-60457N

Protein interaction database and analysis system

More...IntActi		Q9Y5S8, 5 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000362057

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q9Y5S8

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9Y5S8, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		Q9Y5S8

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9Y5S8

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini54 – 283Ferric oxidoreductaseAdd BLAST230
Domaini284 – 391FAD-binding FR-typePROSITE-ProRule annotationAdd BLAST108

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni397 – 536Interaction with NOXO11 PublicationAdd BLAST140

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0039, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000161632

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_005646_3_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9Y5S8

Identification of Orthologs from Complete Genome Data

More...OMAi		HRTYISK

Database of Orthologous Groups

More...OrthoDBi		936110at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9Y5S8

TreeFam database of animal gene trees

More...TreeFami		TF105354

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.50.80, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000778, Cyt_b245_heavy_chain
IPR013112, FAD-bd_8
IPR017927, FAD-bd_FR_type
IPR013130, Fe3_Rdtase_TM_dom
IPR013121, Fe_red_NAD-bd_6
IPR039261, FNR_nucleotide-bd
IPR029650, NOX1
IPR017938, Riboflavin_synthase-like_b-brl

The PANTHER Classification System

More...PANTHERi		PTHR11972:SF71, PTHR11972:SF71, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF08022, FAD_binding_8, 1 hit
PF01794, Ferric_reduct, 1 hit
PF08030, NAD_binding_6, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00466, GP91PHOX

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF52343, SSF52343, 1 hit
SSF63380, SSF63380, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51384, FAD_FR, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform NOH-1L (identifier: Q9Y5S8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGNWVVNHWF SVLFLVVWLG LNVFLFVDAF LKYEKADKYY YTRKILGSTL 
        60         70         80         90        100
ACARASALCL NFNSTLILLP VCRNLLSFLR GTCSFCSRTL RKQLDHNLTF 
       110        120        130        140        150
HKLVAYMICL HTAIHIIAHL FNFDCYSRSR QATDGSLASI LSSLSHDEKK 
       160        170        180        190        200
GGSWLNPIQS RNTTVEYVTF TSIAGLTGVI MTIALILMVT SATEFIRRSY 
       210        220        230        240        250
FEVFWYTHHL FIFYILGLGI HGIGGIVRGQ TEESMNESHP RKCAESFEMW 
       260        270        280        290        300
DDRDSHCRRP KFEGHPPESW KWILAPVILY ICERILRFYR SQQKVVITKV 
       310        320        330        340        350
VMHPSKVLEL QMNKRGFSME VGQYIFVNCP SISLLEWHPF TLTSAPEEDF 
       360        370        380        390        400
FSIHIRAAGD WTENLIRAFE QQYSPIPRIE VDGPFGTASE DVFQYEVAVL 
       410        420        430        440        450
VGAGIGVTPF ASILKSIWYK FQCADHNLKT KKIYFYWICR ETGAFSWFNN 
       460        470        480        490        500
LLTSLEQEME ELGKVGFLNY RLFLTGWDSN IVGHAALNFD KATDIVTGLK 
       510        520        530        540        550
QKTSFGRPMW DNEFSTIATS HPKSVVGVFL CGPRTLAKSL RKCCHRYSSL 
       560 
DPRKVQFYFN KENF
Length:564
Mass (Da):64,871
Last modified:May 1, 2000 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC3BE290F4E6DBC9A
GO
Isoform NOH-1S (identifier: Q9Y5S8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     159-190: QSRNTTVEYVTFTSIAGLTGVIMTIALILMVT → HPHITPTVYMFTVTFDMVLSSVNSNLLFLLIK
     191-564: Missing.

Show »
Length:190
Mass (Da):21,704
Checksum:i75C0B809E9AE8E3D
GO
Isoform NOH-1LV (identifier: Q9Y5S8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     433-481: Missing.

Show »
Length:515
Mass (Da):58,972
Checksum:i1D79577159D69688
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A6NGA6A6NGA6_HUMAN
NADPH oxidase 1
NOX1
527Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5H9D4Q5H9D4_HUMAN
NADPH oxidase 1
NOX1
192Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y581H0Y581_HUMAN
NADPH oxidase 1
NOX1
175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti173I → V in AAD38133 (PubMed:10615049).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_049101315R → H. Corresponds to variant dbSNP:rs2071756Ensembl.1
Natural variantiVAR_075548330P → S Found in a patient with very early onset inflammatory bowel disease; unknown pathological significance; no effect on subcellular location; significantly reduced basal and phorbol ester-stimulated ROS generation, which may decrease resistance to infection by enteric pathogens, such as Campylobacter jejuni. 1 Publication1
Natural variantiVAR_061176360D → N Found in a patient with very early onset inflammatory bowel disease; unknown pathological significance; no effect on subcellular location; significantly reduced basal and phorbol ester-stimulated ROS generation, which may decrease resistance to infection by enteric pathogens, such as Campylobacter jejuni. 1 PublicationCorresponds to variant dbSNP:rs34688635Ensembl.1
Natural variantiVAR_049102378R → K. Corresponds to variant dbSNP:rs35404864EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_001577159 – 190QSRNT…ILMVT → HPHITPTVYMFTVTFDMVLS SVNSNLLFLLIK in isoform NOH-1S. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_001578191 – 564Missing in isoform NOH-1S. 1 PublicationAdd BLAST374
Alternative sequenceiVSP_001579433 – 481Missing in isoform NOH-1LV. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF127763 mRNA Translation: AAD38133.1
AF166326 mRNA Translation: AAF23232.1
AF166327 mRNA Translation: AAF23233.1
AF166328 mRNA Translation: AAF23234.1
DQ314883 Genomic DNA Translation: ABC40742.1
AK292201 mRNA Translation: BAF84890.1
Z83819 Genomic DNA No translation available.
CH471115 Genomic DNA Translation: EAX02820.1
BC075014 mRNA Translation: AAH75014.1
BC075015 mRNA Translation: AAH75015.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS14474.1 [Q9Y5S8-1]
CCDS14475.1 [Q9Y5S8-3]

NCBI Reference Sequences

More...RefSeqi		NP_001258744.1, NM_001271815.1
NP_008983.2, NM_007052.4 [Q9Y5S8-1]
NP_039249.1, NM_013955.2 [Q9Y5S8-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000217885.5; ENSP00000217885.5; ENSG00000007952.18 [Q9Y5S8-3]
ENST00000372966.8; ENSP00000362057.3; ENSG00000007952.18

Database of genes from NCBI RefSeq genomes

More...GeneIDi		27035

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:27035

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000372966.8; ENSP00000362057.3; NM_007052.5; NP_008983.2

UCSC genome browser

More...UCSCi		uc004egj.3, human [Q9Y5S8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF127763 mRNA Translation: AAD38133.1
AF166326 mRNA Translation: AAF23232.1
AF166327 mRNA Translation: AAF23233.1
AF166328 mRNA Translation: AAF23234.1
DQ314883 Genomic DNA Translation: ABC40742.1
AK292201 mRNA Translation: BAF84890.1
Z83819 Genomic DNA No translation available.
CH471115 Genomic DNA Translation: EAX02820.1
BC075014 mRNA Translation: AAH75014.1
BC075015 mRNA Translation: AAH75015.1
CCDSiCCDS14474.1 [Q9Y5S8-1]
CCDS14475.1 [Q9Y5S8-3]
RefSeqiNP_001258744.1, NM_001271815.1
NP_008983.2, NM_007052.4 [Q9Y5S8-1]
NP_039249.1, NM_013955.2 [Q9Y5S8-3]

3D structure databases

AlphaFoldDBiQ9Y5S8
SMRiQ9Y5S8
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi117966, 11 interactors
DIPiDIP-60457N
IntActiQ9Y5S8, 5 interactors
STRINGi9606.ENSP00000362057

Chemistry databases

BindingDBiQ9Y5S8
ChEMBLiCHEMBL1287628
DrugBankiDB09140, Oxygen
GuidetoPHARMACOLOGYi3001

Protein family/group databases

PeroxiBasei5410, HsNOx01
TCDBi5.B.1.1.3, the phagocyte (gp91(phox)) nadph oxidase family

PTM databases

GlyGeniQ9Y5S8, 2 sites
iPTMnetiQ9Y5S8
PhosphoSitePlusiQ9Y5S8

Genetic variation databases

BioMutaiNOX1
DMDMi8134597

Proteomic databases

jPOSTiQ9Y5S8
MassIVEiQ9Y5S8
PaxDbiQ9Y5S8
PeptideAtlasiQ9Y5S8
PRIDEiQ9Y5S8
ProteomicsDBi86491 [Q9Y5S8-1]
86492 [Q9Y5S8-2]
86493 [Q9Y5S8-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		28538, 370 antibodies from 34 providers

The DNASU plasmid repository

More...DNASUi		27035

Genome annotation databases

EnsembliENST00000217885.5; ENSP00000217885.5; ENSG00000007952.18 [Q9Y5S8-3]
ENST00000372966.8; ENSP00000362057.3; ENSG00000007952.18
GeneIDi27035
KEGGihsa:27035
MANE-SelectiENST00000372966.8; ENSP00000362057.3; NM_007052.5; NP_008983.2
UCSCiuc004egj.3, human [Q9Y5S8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		27035
DisGeNETi27035

GeneCards: human genes, protein and diseases

More...GeneCardsi		NOX1
HGNCiHGNC:7889, NOX1
HPAiENSG00000007952, Tissue enriched (intestine)
MIMi300225, gene
neXtProtiNX_Q9Y5S8
OpenTargetsiENSG00000007952
PharmGKBiPA31690
VEuPathDBiHostDB:ENSG00000007952

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0039, Eukaryota
GeneTreeiENSGT00940000161632
HOGENOMiCLU_005646_3_1_1
InParanoidiQ9Y5S8
OMAiHRTYISK
OrthoDBi936110at2759
PhylomeDBiQ9Y5S8
TreeFamiTF105354

Enzyme and pathway databases

PathwayCommonsiQ9Y5S8
ReactomeiR-HSA-5668599, RHO GTPases Activate NADPH Oxidases
R-HSA-9013149, RAC1 GTPase cycle
R-HSA-9013423, RAC3 GTPase cycle
R-HSA-9673324, WNT5:FZD7-mediated leishmania damping
SignaLinkiQ9Y5S8
SIGNORiQ9Y5S8

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		27035, 8 hits in 694 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		NOX1, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		NOX1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		27035
PharosiQ9Y5S8, Tchem

Protein Ontology

More...PROi		PR:Q9Y5S8
RNActiQ9Y5S8, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000007952, Expressed in colonic mucosa and 141 other tissues
ExpressionAtlasiQ9Y5S8, baseline and differential
GenevisibleiQ9Y5S8, HS

Family and domain databases

Gene3Di3.40.50.80, 1 hit
InterProiView protein in InterPro
IPR000778, Cyt_b245_heavy_chain
IPR013112, FAD-bd_8
IPR017927, FAD-bd_FR_type
IPR013130, Fe3_Rdtase_TM_dom
IPR013121, Fe_red_NAD-bd_6
IPR039261, FNR_nucleotide-bd
IPR029650, NOX1
IPR017938, Riboflavin_synthase-like_b-brl
PANTHERiPTHR11972:SF71, PTHR11972:SF71, 1 hit
PfamiView protein in Pfam
PF08022, FAD_binding_8, 1 hit
PF01794, Ferric_reduct, 1 hit
PF08030, NAD_binding_6, 1 hit
PRINTSiPR00466, GP91PHOX
SUPFAMiSSF52343, SSF52343, 1 hit
SSF63380, SSF63380, 1 hit
PROSITEiView protein in PROSITE
PS51384, FAD_FR, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNOX1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y5S8
Secondary accession number(s): A8K836, O95691, Q2PP02
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 1, 2000
Last modified: May 25, 2022
This is version 187 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again