Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Due to a server migration, the UniProt 'ID mapping', 'Peptide search' and 'community bibliography submission' tools will not be available on the 19th April 2021 during the morning (EST).

UniProtKB - Q9Y5K3 (PCY1B_HUMAN)

Entry version 164 (07 Apr 2021)
Sequence version 1 (01 Nov 1999)
Previous versions | rss
Add a publicationFeedback
Protein

Choline-phosphate cytidylyltransferase B

Gene

PCYT1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the key rate-limiting step in the CDP-choline pathway for phosphatidylcholine biosynthesis.2 Publications
Catalyzes the key rate-limiting step in the CDP-choline pathway for phosphatidylcholine biosynthesis.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: phosphatidylcholine biosynthesis

This protein is involved in step 1 of the subpathway that synthesizes phosphatidylcholine from phosphocholine.2 Publications
Proteins known to be involved in the 2 steps of the subpathway in this organism are:
  1. Choline-phosphate cytidylyltransferase B (PCYT1B), Choline-phosphate cytidylyltransferase A (PCYT1A)
  2. Cholinephosphotransferase 1 (CHPT1), Choline/ethanolaminephosphotransferase 1 (CEPT1)
This subpathway is part of the pathway phosphatidylcholine biosynthesis, which is itself part of Phospholipid metabolism.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes phosphatidylcholine from phosphocholine, the pathway phosphatidylcholine biosynthesis and in Phospholipid metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei122CTPBy similarity1
Binding sitei122SubstrateBy similarity1
Binding sitei151SubstrateBy similarity1
Binding sitei173CTPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi84 – 92CTPBy similarity9
Nucleotide bindingi168 – 169CTPBy similarity2
Nucleotide bindingi196 – 200CTPBy similarity5

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionNucleotidyltransferase, Transferase
Biological processLipid biosynthesis, Lipid metabolism, Phospholipid biosynthesis, Phospholipid metabolism

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9Y5K3

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-1483191, Synthesis of PC

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...UniPathwayi		UPA00753;UER00739

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...SwissLipidsi		SLP:000001754

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Choline-phosphate cytidylyltransferase B (EC:2.7.7.152 Publications)
Alternative name(s):
CCT-beta
CTP:phosphocholine cytidylyltransferase B
Short name:
CCT B
Short name:
CT B
Phosphorylcholine transferase B
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PCYT1B
Synonyms:CCTB
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:8755, PCYT1B

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		300948, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9Y5K3

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000102230.13

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		9468

Open Targets

More...OpenTargetsi		ENSG00000102230

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA33100

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9Y5K3, Tbio

Chemistry databases

Drug and drug target database

More...DrugBanki		DB00122, Choline
DB14006, Choline salicylate

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PCYT1B

Domain mapping of disease mutations (DMDM)

More...DMDMi		12643330

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002084561 – 369Choline-phosphate cytidylyltransferase BAdd BLAST369

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei315PhosphoserineCombined sources1
Modified residuei319PhosphoserineCombined sources1
Modified residuei322PhosphoserineBy similarity1
Modified residuei323PhosphoserineBy similarity1
Modified residuei329PhosphoserineBy similarity1
Modified residuei331PhosphoserineBy similarity1
Modified residuei335PhosphoserineBy similarity1
Modified residuei345PhosphothreonineBy similarity1
Modified residuei346PhosphoserineBy similarity1
Modified residuei349PhosphoserineBy similarity1
Modified residuei350PhosphoserineBy similarity1
Modified residuei355PhosphoserineBy similarity1
Modified residuei360PhosphoserineBy similarity1
Modified residuei362PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated.1 Publication
Extensively phosphorylated.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9Y5K3

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9Y5K3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9Y5K3

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9Y5K3

PeptideAtlas

More...PeptideAtlasi		Q9Y5K3

PRoteomics IDEntifications database

More...PRIDEi		Q9Y5K3

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		19606
86427 [Q9Y5K3-1]
86428 [Q9Y5K3-2]
86429 [Q9Y5K3-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9Y5K3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9Y5K3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in testis, placenta, brain, ovary, liver and fetal lung.2 Publications
Expressed in brain, liver and fetal lung.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000102230, Expressed in testis and 186 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9Y5K3, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9Y5K3, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000102230, Tissue enhanced (brain, testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		114854, 11 interactors

Protein interaction database and analysis system

More...IntActi		Q9Y5K3, 4 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000368439

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9Y5K3, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9Y5K3

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the cytidylyltransferase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2804, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156040

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_034585_4_2_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9Y5K3

Identification of Orthologs from Complete Genome Data

More...OMAi		TSCQCRA

Database of Orthologous Groups

More...OrthoDBi		1172502at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9Y5K3

TreeFam database of animal gene trees

More...TreeFami		TF106336

Family and domain databases

Conserved Domains Database

More...CDDi		cd02174, CCT, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.50.620, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR041723, CCT
IPR004821, Cyt_trans-like
IPR014729, Rossmann-like_a/b/a_fold

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01467, CTP_transf_like, 1 hit

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR00125, cyt_tran_rel, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 2 (identifier: Q9Y5K3-1) [UniParc]FASTAAdd to basket
Also known as: Beta-21 Publication

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPVVTTDAES ETGIPKSLSN EPPSETMEEI EHTCPQPRLT LTAPAPFADE 
        60         70         80         90        100
TNCQCQAPHE KLTIAQARLG TPADRPVRVY ADGIFDLFHS GHARALMQAK 
       110        120        130        140        150
TLFPNSYLLV GVCSDDLTHK FKGFTVMNEA ERYEALRHCR YVDEVIRDAP 
       160        170        180        190        200
WTLTPEFLEK HKIDFVAHDD IPYSSAGSDD VYKHIKEAGM FVPTQRTEGI 
       210        220        230        240        250
STSDIITRIV RDYDVYARRN LQRGYTAKEL NVSFINEKRY RFQNQVDKMK 
       260        270        280        290        300
EKVKNVEERS KEFVNRVEEK SHDLIQKWEE KSREFIGNFL ELFGPDGAWK 
       310        320        330        340        350
QMFQERSSRM LQALSPKQSP VSSPTRSRSP SRSPSPTFSW LPLKTSPPSS 
       360 
PKAASASISS MSEGDEDEK
Length:369
Mass (Da):41,940
Last modified:November 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i87A00617DF690DD1
GO
Isoform 1 (identifier: Q9Y5K3-2) [UniParc]FASTAAdd to basket
Also known as: Beta-11 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     321-369: VSSPTRSRSPSRSPSPTFSWLPLKTSPPSSPKAASASISSMSEGDEDEK → LKSWARCRDF

Show »
Length:330
Mass (Da):38,086
Checksum:iC1A16BC1B61906B2
GO
Isoform 3 (identifier: Q9Y5K3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: Missing.
     17-39: SLSNEPPSETMEEIEHTCPQPRL → MVGNQECIMEEDNRAPQLWRK

Show »
Length:351
Mass (Da):40,206
Checksum:i0E2BBEDD2569EAA8
GO
Isoform 4 (identifier: Q9Y5K3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRL → MVGHQECIMEEDNRAPQLWRK

Show »
Length:351
Mass (Da):40,229
Checksum:i89BA4A3D7F09B353
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F2Z2B1F2Z2B1_HUMAN
Choline-phosphate cytidylyltransfer...
PCYT1B
177Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti154T → S in BAG59022 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0446591 – 39MPVVT…PQPRL → MVGHQECIMEEDNRAPQLWR K in isoform 4. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_0200451 – 16Missing in isoform 3. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_02004617 – 39SLSNE…PQPRL → MVGNQECIMEEDNRAPQLWR K in isoform 3. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_001226321 – 369VSSPT…DEDEK → LKSWARCRDF in isoform 1. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF052510 mRNA Translation: AAC39754.1
AF148464 mRNA Translation: AAD35088.1
AK296333 mRNA Translation: BAG59022.1
AK315323 mRNA Translation: BAG37725.1
EU181262 Genomic DNA Translation: ABW03924.1
AC079168 Genomic DNA No translation available.
CH471074 Genomic DNA Translation: EAW99021.1
BC045634 mRNA Translation: AAH45634.2

The Consensus CDS (CCDS) project

More...CCDSi		CCDS14213.1 [Q9Y5K3-1]
CCDS55391.1 [Q9Y5K3-2]
CCDS55392.1 [Q9Y5K3-4]

NCBI Reference Sequences

More...RefSeqi		NP_001156736.1, NM_001163264.1 [Q9Y5K3-4]
NP_001156737.1, NM_001163265.1 [Q9Y5K3-2]
NP_004836.2, NM_004845.4 [Q9Y5K3-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000356768; ENSP00000349211; ENSG00000102230 [Q9Y5K3-2]
ENST00000379144; ENSP00000368439; ENSG00000102230 [Q9Y5K3-1]
ENST00000379145; ENSP00000368440; ENSG00000102230 [Q9Y5K3-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		9468

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:9468

UCSC genome browser

More...UCSCi		uc004dbi.4, human [Q9Y5K3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF052510 mRNA Translation: AAC39754.1
AF148464 mRNA Translation: AAD35088.1
AK296333 mRNA Translation: BAG59022.1
AK315323 mRNA Translation: BAG37725.1
EU181262 Genomic DNA Translation: ABW03924.1
AC079168 Genomic DNA No translation available.
CH471074 Genomic DNA Translation: EAW99021.1
BC045634 mRNA Translation: AAH45634.2
CCDSiCCDS14213.1 [Q9Y5K3-1]
CCDS55391.1 [Q9Y5K3-2]
CCDS55392.1 [Q9Y5K3-4]
RefSeqiNP_001156736.1, NM_001163264.1 [Q9Y5K3-4]
NP_001156737.1, NM_001163265.1 [Q9Y5K3-2]
NP_004836.2, NM_004845.4 [Q9Y5K3-1]

3D structure databases

SMRiQ9Y5K3
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi114854, 11 interactors
IntActiQ9Y5K3, 4 interactors
STRINGi9606.ENSP00000368439

Chemistry databases

DrugBankiDB00122, Choline
DB14006, Choline salicylate
SwissLipidsiSLP:000001754

PTM databases

iPTMnetiQ9Y5K3
PhosphoSitePlusiQ9Y5K3

Genetic variation databases

BioMutaiPCYT1B
DMDMi12643330

Proteomic databases

EPDiQ9Y5K3
jPOSTiQ9Y5K3
MassIVEiQ9Y5K3
PaxDbiQ9Y5K3
PeptideAtlasiQ9Y5K3
PRIDEiQ9Y5K3
ProteomicsDBi19606
86427 [Q9Y5K3-1]
86428 [Q9Y5K3-2]
86429 [Q9Y5K3-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		505, 54 antibodies

Genome annotation databases

EnsembliENST00000356768; ENSP00000349211; ENSG00000102230 [Q9Y5K3-2]
ENST00000379144; ENSP00000368439; ENSG00000102230 [Q9Y5K3-1]
ENST00000379145; ENSP00000368440; ENSG00000102230 [Q9Y5K3-4]
GeneIDi9468
KEGGihsa:9468
UCSCiuc004dbi.4, human [Q9Y5K3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		9468
DisGeNETi9468

GeneCards: human genes, protein and diseases

More...GeneCardsi		PCYT1B
HGNCiHGNC:8755, PCYT1B
HPAiENSG00000102230, Tissue enhanced (brain, testis)
MIMi300948, gene
neXtProtiNX_Q9Y5K3
OpenTargetsiENSG00000102230
PharmGKBiPA33100
VEuPathDBiHostDB:ENSG00000102230.13

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2804, Eukaryota
GeneTreeiENSGT00940000156040
HOGENOMiCLU_034585_4_2_1
InParanoidiQ9Y5K3
OMAiTSCQCRA
OrthoDBi1172502at2759
PhylomeDBiQ9Y5K3
TreeFamiTF106336

Enzyme and pathway databases

UniPathwayiUPA00753;UER00739
PathwayCommonsiQ9Y5K3
ReactomeiR-HSA-1483191, Synthesis of PC

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		9468, 2 hits in 606 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PCYT1B, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		PCYT1B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		9468
PharosiQ9Y5K3, Tbio

Protein Ontology

More...PROi		PR:Q9Y5K3
RNActiQ9Y5K3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000102230, Expressed in testis and 186 other tissues
ExpressionAtlasiQ9Y5K3, baseline and differential
GenevisibleiQ9Y5K3, HS

Family and domain databases

CDDicd02174, CCT, 1 hit
Gene3Di3.40.50.620, 1 hit
InterProiView protein in InterPro
IPR041723, CCT
IPR004821, Cyt_trans-like
IPR014729, Rossmann-like_a/b/a_fold
PfamiView protein in Pfam
PF01467, CTP_transf_like, 1 hit
TIGRFAMsiTIGR00125, cyt_tran_rel, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPCY1B_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y5K3
Secondary accession number(s): A8IX00
, B2RCX8, B4DK10, E9PD84, O60621, Q86XC9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 24, 2001
Last sequence update: November 1, 1999
Last modified: April 7, 2021
This is version 164 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again