Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 175 (10 Feb 2021)
Sequence version 1 (01 Nov 1999)
Previous versions | rss
Add a publicationFeedback
Protein

Protocadherin alpha-5

Gene

PCDHA5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Potential calcium-dependent cell-adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • cell adhesion Source: GO_Central
  • homophilic cell adhesion via plasma membrane adhesion molecules Source: InterPro
  • nervous system development Source: ProtInc

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion
LigandCalcium

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9Y5H7

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protocadherin alpha-5
Short name:
PCDH-alpha-5
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PCDHA5
Synonyms:CNRS6
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:8671, PCDHA5

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604966, gene
606311, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y5H7

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000204965.8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini29 – 696ExtracellularSequence analysisAdd BLAST668
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei697 – 717HelicalSequence analysisAdd BLAST21
Topological domaini718 – 936CytoplasmicSequence analysisAdd BLAST219

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
56143

Open Targets

More...
OpenTargetsi
ENSG00000204965

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33017

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9Y5H7, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PCDHA5

Domain mapping of disease mutations (DMDM)

More...
DMDMi
13878428

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 28Sequence analysisAdd BLAST28
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000389229 – 936Protocadherin alpha-5Add BLAST908

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi264N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi547N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9Y5H7

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9Y5H7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9Y5H7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y5H7

PeptideAtlas

More...
PeptideAtlasi
Q9Y5H7

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y5H7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
86396 [Q9Y5H7-1]
86397 [Q9Y5H7-2]
86398 [Q9Y5H7-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q9Y5H7, 2 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y5H7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y5H7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000204965, Expressed in prefrontal cortex and 54 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Y5H7, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000204965, Tissue enriched (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
121083, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q9Y5H7, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000436557

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9Y5H7, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Y5H7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini33 – 132Cadherin 1PROSITE-ProRule annotationAdd BLAST100
Domaini156 – 241Cadherin 2PROSITE-ProRule annotationAdd BLAST86
Domaini242 – 349Cadherin 3PROSITE-ProRule annotationAdd BLAST108
Domaini350 – 454Cadherin 4PROSITE-ProRule annotationAdd BLAST105
Domaini455 – 564Cadherin 5PROSITE-ProRule annotationAdd BLAST110
Domaini580 – 677Cadherin 6PROSITE-ProRule annotationAdd BLAST98
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati773 – 776PXXP 14
Repeati785 – 788PXXP 24
Repeati818 – 821PXXP 34
Repeati873 – 876PXXP 44
Repeati877 – 890PXXP 5Add BLAST14

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni773 – 8905 X 4 AA repeats of P-X-X-PAdd BLAST118

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi909 – 916Poly-Lys8

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3594, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000164408

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_006480_3_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y5H7

Identification of Orthologs from Complete Genome Data

More...
OMAi
LDYEDCK

Database of Orthologous Groups

More...
OrthoDBi
184745at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y5H7

TreeFam database of animal gene trees

More...
TreeFami
TF332299

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002126, Cadherin-like_dom
IPR015919, Cadherin-like_sf
IPR031904, Cadherin_CBD
IPR020894, Cadherin_CS
IPR013164, Cadherin_N

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00028, Cadherin, 5 hits
PF08266, Cadherin_2, 1 hit
PF15974, Cadherin_tail, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00205, CADHERIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00112, CA, 6 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49313, SSF49313, 6 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00232, CADHERIN_1, 5 hits
PS50268, CADHERIN_2, 6 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9Y5H7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVYSRRGSLG SRLLLLWLLL AYWKAGSGQL HYSIPEEAKH GTFVGRIAQD
60 70 80 90 100
LGLELAELVP RLFRVASKGR GDLLEVNLQN GILFVNSRID REELCRRRAE
110 120 130 140 150
CSIHLEVIVD RPLQVFHVEV AVKDINDNPP RFSRQEQRLF ILESRMPDSR
160 170 180 190 200
FPLEGASDLD IGANAQLRYR LNPNEYFDLD VKTNEEETNF LELVLRKSLD
210 220 230 240 250
REETQEHRLL VIATDGGKPE LTGTVQLLIN VLDANDNAPE FDKSIYNVRL
260 270 280 290 300
LENAPSGTLV IKLNASDADE GINKEIVYFF SNLVLDDVKS KFIINSNTGE
310 320 330 340 350
IKVNGELDYE DYNSYEINID AMDKSTFPLS GHCKVVVKLL DVNDNTPEMA
360 370 380 390 400
ITTLFLPVKE DAPLSTVIAL ISVSDRDSGA NGQVTCSLMP HVPFKLVSTF
410 420 430 440 450
KNYYSLVLDS ALDRESVSVY ELVVTARDGG SPSLWATASV SVEVADVNDN
460 470 480 490 500
APAFAQPQYT VFVKENNPPG CHIFTVSARD ADAQENALVS YSLVERRVGE
510 520 530 540 550
RPLSSYVSVH AESGKVYALQ PLDHEEVELL QFQVSARDAG VPPLGSNVTL
560 570 580 590 600
QVFVLDENDN APALLVPRVG GTGGAVSELV PRSVGAGHVV AKVRAVDPDS
610 620 630 640 650
GYNAWLSYEL QPAPGSARIP FRVGLYTGEI STTRSLDETE APRHRLLVLV
660 670 680 690 700
KDHGEPPLTA TATVLVSLVE SGQAPKASSR ASAGAVGPEA ALVDVNVYLI
710 720 730 740 750
IAICAVSSLL VLTLLLYTAL RCSAQPTEAV CTRGKPTLLC SSAVGSWSYS
760 770 780 790 800
QQRRQRVCSG EAPPKTDLMA FSPSLPQGPT STDNPRQPNP DWRYSASLRA
810 820 830 840 850
GMHSSVHLEE AGILRAGPGG PDQQWPTVSS ATPEPEAGEV SPPVGAGVNS
860 870 880 890 900
NSWTFKYGPG NPKQSGPGEL PDKFIIPGSP AIISIRQEPT NSQIDKSDFI
910 920 930
TFGKKEETKK KKKKKKGNKT QEKKEKGNST TDNSDQ
Length:936
Mass (Da):102,048
Last modified:November 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7143EECE1A357CD6
GO
Isoform 2 (identifier: Q9Y5H7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     785-816: PRQPNPDWRYSASLRAGMHSSVHLEEAGILRA → VSFLILTSIFPSQFSNIKCHIHPLFLYLKIMS
     817-936: Missing.

Show »
Length:816
Mass (Da):89,349
Checksum:i3866970F5657BF16
GO
Isoform 3 (identifier: Q9Y5H7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     868-890: GELPDKFIIPGSPAIISIRQEPT → EPKKQTQVSFLLRRKGEASQPRQ
     891-936: Missing.

Show »
Length:890
Mass (Da):96,996
Checksum:iFD9B5EA33572A7E3
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti237N → S in AAH33735 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_048526691A → V. Corresponds to variant dbSNP:rs4141841Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_000679785 – 816PRQPN…GILRA → VSFLILTSIFPSQFSNIKCH IHPLFLYLKIMS in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_000680817 – 936Missing in isoform 2. 1 PublicationAdd BLAST120
Alternative sequenceiVSP_008704868 – 890GELPD…RQEPT → EPKKQTQVSFLLRRKGEASQ PRQ in isoform 3. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_008705891 – 936Missing in isoform 3. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF152313 mRNA Translation: AAD43707.1
AF152483 mRNA Translation: AAD43744.1
AC005609 Genomic DNA Translation: AAC34321.1
BC033735 mRNA Translation: AAH33735.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS54917.1 [Q9Y5H7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_061731.1, NM_018908.2 [Q9Y5H7-1]
NP_113689.1, NM_031501.1 [Q9Y5H7-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000529619; ENSP00000433416; ENSG00000204965 [Q9Y5H7-3]
ENST00000529859; ENSP00000436557; ENSG00000204965 [Q9Y5H7-1]
ENST00000614258; ENSP00000484128; ENSG00000204965 [Q9Y5H7-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
56143

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:56143

UCSC genome browser

More...
UCSCi
uc003lhj.2, human [Q9Y5H7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF152313 mRNA Translation: AAD43707.1
AF152483 mRNA Translation: AAD43744.1
AC005609 Genomic DNA Translation: AAC34321.1
BC033735 mRNA Translation: AAH33735.1
CCDSiCCDS54917.1 [Q9Y5H7-1]
RefSeqiNP_061731.1, NM_018908.2 [Q9Y5H7-1]
NP_113689.1, NM_031501.1 [Q9Y5H7-2]

3D structure databases

SMRiQ9Y5H7
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi121083, 3 interactors
IntActiQ9Y5H7, 2 interactors
STRINGi9606.ENSP00000436557

PTM databases

GlyGeniQ9Y5H7, 2 sites
iPTMnetiQ9Y5H7
PhosphoSitePlusiQ9Y5H7

Genetic variation databases

BioMutaiPCDHA5
DMDMi13878428

Proteomic databases

EPDiQ9Y5H7
jPOSTiQ9Y5H7
MassIVEiQ9Y5H7
PaxDbiQ9Y5H7
PeptideAtlasiQ9Y5H7
PRIDEiQ9Y5H7
ProteomicsDBi86396 [Q9Y5H7-1]
86397 [Q9Y5H7-2]
86398 [Q9Y5H7-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
27127, 135 antibodies

Genome annotation databases

EnsembliENST00000529619; ENSP00000433416; ENSG00000204965 [Q9Y5H7-3]
ENST00000529859; ENSP00000436557; ENSG00000204965 [Q9Y5H7-1]
ENST00000614258; ENSP00000484128; ENSG00000204965 [Q9Y5H7-2]
GeneIDi56143
KEGGihsa:56143
UCSCiuc003lhj.2, human [Q9Y5H7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
56143
DisGeNETi56143

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PCDHA5
HGNCiHGNC:8671, PCDHA5
HPAiENSG00000204965, Tissue enriched (brain)
MIMi604966, gene
606311, gene
neXtProtiNX_Q9Y5H7
OpenTargetsiENSG00000204965
PharmGKBiPA33017
VEuPathDBiHostDB:ENSG00000204965.8

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3594, Eukaryota
GeneTreeiENSGT00940000164408
HOGENOMiCLU_006480_3_0_1
InParanoidiQ9Y5H7
OMAiLDYEDCK
OrthoDBi184745at2759
PhylomeDBiQ9Y5H7
TreeFamiTF332299

Enzyme and pathway databases

PathwayCommonsiQ9Y5H7

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
56143, 1 hit in 842 CRISPR screens

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PCDHA5

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
56143
PharosiQ9Y5H7, Tdark

Protein Ontology

More...
PROi
PR:Q9Y5H7
RNActiQ9Y5H7, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000204965, Expressed in prefrontal cortex and 54 other tissues
GenevisibleiQ9Y5H7, HS

Family and domain databases

InterProiView protein in InterPro
IPR002126, Cadherin-like_dom
IPR015919, Cadherin-like_sf
IPR031904, Cadherin_CBD
IPR020894, Cadherin_CS
IPR013164, Cadherin_N
PfamiView protein in Pfam
PF00028, Cadherin, 5 hits
PF08266, Cadherin_2, 1 hit
PF15974, Cadherin_tail, 1 hit
PRINTSiPR00205, CADHERIN
SMARTiView protein in SMART
SM00112, CA, 6 hits
SUPFAMiSSF49313, SSF49313, 6 hits
PROSITEiView protein in PROSITE
PS00232, CADHERIN_1, 5 hits
PS50268, CADHERIN_2, 6 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPCDA5_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y5H7
Secondary accession number(s): O75284, Q8N4R3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: November 1, 1999
Last modified: February 10, 2021
This is version 175 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human variants curated from literature reports
    Index of human variants curated from literature reports
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  4. Human entries with genetic variants
    List of human entries with genetic variants
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again