Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ankyrin repeat and SOCS box protein 3

Gene

ASB3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes TNFRSF1B.1 Publication

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

GO - Biological processi

Keywordsi

Biological processUbl conjugation pathway

Enzyme and pathway databases

ReactomeiR-HSA-8951664 Neddylation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
UniPathwayi
UPA00143

Names & Taxonomyi

Protein namesi
Recommended name:
Ankyrin repeat and SOCS box protein 3
Short name:
ASB-3
Gene namesi
Name:ASB3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000115239.21
HGNCiHGNC:16013 ASB3
MIMi605760 gene
neXtProtiNX_Q9Y575

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000115239
PharmGKBiPA25031

Polymorphism and mutation databases

BioMutaiASB3
DMDMi20532004

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000669261 – 518Ankyrin repeat and SOCS box protein 3Add BLAST518

Proteomic databases

PaxDbiQ9Y575
PeptideAtlasiQ9Y575
PRIDEiQ9Y575
ProteomicsDBi86306
86307 [Q9Y575-2]

PTM databases

iPTMnetiQ9Y575
PhosphoSitePlusiQ9Y575

Expressioni

Gene expression databases

BgeeiENSG00000115239 Expressed in 89 organ(s), highest expression level in corpus callosum
CleanExiHS_ASB3
ExpressionAtlasiQ9Y575 baseline and differential
GenevisibleiQ9Y575 HS

Organism-specific databases

HPAiHPA003940

Interactioni

Subunit structurei

Interacts with ELOB and TNFRSF1B.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
SH2D2AQ9NP313EBI-2875625,EBI-490630

Protein-protein interaction databases

BioGridi119317, 70 interactors
IntActiQ9Y575, 12 interactors
MINTiQ9Y575
STRINGi9606.ENSP00000313756

Structurei

3D structure databases

ProteinModelPortaliQ9Y575
SMRiQ9Y575
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati9 – 38ANK 1Add BLAST30
Repeati42 – 71ANK 2Add BLAST30
Repeati78 – 107ANK 3Add BLAST30
Repeati111 – 140ANK 4Add BLAST30
Repeati145 – 174ANK 5Add BLAST30
Repeati178 – 207ANK 6Add BLAST30
Repeati211 – 240ANK 7Add BLAST30
Repeati246 – 275ANK 8Add BLAST30
Repeati279 – 308ANK 9Add BLAST30
Repeati315 – 346ANK 10Add BLAST32
Repeati348 – 373ANK 11Add BLAST26
Domaini441 – 504SOCS boxPROSITE-ProRule annotationAdd BLAST64

Domaini

The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin-protein ligase complexes.By similarity

Sequence similaritiesi

Belongs to the ankyrin SOCS box (ASB) family.Curated

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiKOG0504 Eukaryota
COG0666 LUCA
GeneTreeiENSGT00930000150873
HOGENOMiHOG000022587
HOVERGENiHBG024356
InParanoidiQ9Y575
KOiK10325
OMAiGHEECLE
OrthoDBiEOG091G03ZR
PhylomeDBiQ9Y575
TreeFamiTF315127

Family and domain databases

CDDicd00204 ANK, 2 hits
cd03722 SOCS_ASB3, 1 hit
Gene3Di1.25.40.20, 2 hits
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR037329 ASB3_SOCS
IPR001496 SOCS_box
IPR036036 SOCS_box-like_dom_sf
PfamiView protein in Pfam
PF12796 Ank_2, 2 hits
PF13606 Ank_3, 1 hit
PF07525 SOCS_box, 1 hit
PRINTSiPR01415 ANKYRIN
SMARTiView protein in SMART
SM00248 ANK, 10 hits
SM00969 SOCS_box, 1 hit
SUPFAMiSSF158235 SSF158235, 1 hit
SSF48403 SSF48403, 2 hits
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 6 hits
PS50225 SOCS, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y575-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDFTEAYADT CSTVGLAARE GNVKVLRKLL KKGRSVDVAD NRGWMPIHEA
60 70 80 90 100
AYHNSVECLQ MLINADSSEN YIKMKTFEGF CALHLAASQG HWKIVQILLE
110 120 130 140 150
AGADPNATTL EETTPLFLAV ENGQIDVLRL LLQHGANVNG SHSMCGWNSL
160 170 180 190 200
HQASFQENAE IIKLLLRKGA NKECQDDFGI TPLFVAAQYG KLESLSILIS
210 220 230 240 250
SGANVNCQAL DKATPLFIAA QEGHTKCVEL LLSSGADPDL YCNEDSWQLP
260 270 280 290 300
IHAAAQMGHT KILDLLIPLT NRACDTGLNK VSPVYSAVFG GHEDCLEILL
310 320 330 340 350
RNGYSPDAQA CLVFGFSSPV CMAFQKDCEF FGIVNILLKY GAQINELHLA
360 370 380 390 400
YCLKYEKFSI FRYFLRKGCS LGPWNHIYEF VNHAIKAQAK YKEWLPHLLV
410 420 430 440 450
AGFDPLILLC NSWIDSVSID TLIFTLEFTN WKTLAPAVER MLSARASNAW
460 470 480 490 500
ILQQHIATVP SLTHLCRLEI RSSLKSERLR SDSYISQLPL PRSLHNYLLY
510
EDVLRMYEVP ELAAIQDG
Length:518
Mass (Da):57,745
Last modified:November 1, 1999 - v1
Checksum:iE6FC2EF76DD814DF
GO
Isoform 2 (identifier: Q9Y575-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-73: Missing.

Note: No experimental confirmation available.
Show »
Length:445
Mass (Da):49,617
Checksum:iDF2A006FEA3DD409
GO
Isoform 3 (identifier: Q9Y575-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAMMPLVLHHPERQAELGSGLRDGGGAALRPPGRLVKQM

Note: No experimental confirmation available.
Show »
Length:556
Mass (Da):61,775
Checksum:iA73962ECA9F739CD
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BYZ6H7BYZ6_HUMAN
Ankyrin repeat and SOCS box protein...
ASB3
477Annotation score:

Sequence cautioni

The sequence AAI10916 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti118L → S in BAA91599 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0363921 – 73Missing in isoform 2. 1 PublicationAdd BLAST73
Alternative sequenceiVSP_0446061M → MAMMPLVLHHPERQAELGSG LRDGGGAALRPPGRLVKQM in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF156778 mRNA Translation: AAD41895.1
AK000985 mRNA Translation: BAA91455.1
AK001283 mRNA Translation: BAA91599.1
AK056069 mRNA Translation: BAG51615.1
AC007883 Genomic DNA Translation: AAY24350.1
AC008064 Genomic DNA Translation: AAX93180.1
AC008068 Genomic DNA No translation available.
AC069157 Genomic DNA No translation available.
CH471053 Genomic DNA Translation: EAX00167.1
CH471053 Genomic DNA Translation: EAX00168.1
CH471053 Genomic DNA Translation: EAX00169.1
CH471053 Genomic DNA Translation: EAX00170.1
BC006488 mRNA Translation: AAH06488.1
BC009569 mRNA Translation: AAH09569.1
BC110915 mRNA Translation: AAI10916.1 Different initiation.
CCDSiCCDS1846.1 [Q9Y575-1]
CCDS1847.1 [Q9Y575-2]
RefSeqiNP_001157637.1, NM_001164165.1 [Q9Y575-3]
NP_001188894.1, NM_001201965.1 [Q9Y575-2]
NP_057199.1, NM_016115.4 [Q9Y575-1]
NP_665862.1, NM_145863.2 [Q9Y575-2]
UniGeneiHs.40763

Genome annotation databases

EnsembliENST00000263634; ENSP00000263634; ENSG00000115239 [Q9Y575-1]
ENST00000394717; ENSP00000378206; ENSG00000115239 [Q9Y575-2]
ENST00000406687; ENSP00000384728; ENSG00000115239 [Q9Y575-2]
GeneIDi100302652
51130
KEGGihsa:100302652
hsa:51130
UCSCiuc002rxg.3 human [Q9Y575-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF156778 mRNA Translation: AAD41895.1
AK000985 mRNA Translation: BAA91455.1
AK001283 mRNA Translation: BAA91599.1
AK056069 mRNA Translation: BAG51615.1
AC007883 Genomic DNA Translation: AAY24350.1
AC008064 Genomic DNA Translation: AAX93180.1
AC008068 Genomic DNA No translation available.
AC069157 Genomic DNA No translation available.
CH471053 Genomic DNA Translation: EAX00167.1
CH471053 Genomic DNA Translation: EAX00168.1
CH471053 Genomic DNA Translation: EAX00169.1
CH471053 Genomic DNA Translation: EAX00170.1
BC006488 mRNA Translation: AAH06488.1
BC009569 mRNA Translation: AAH09569.1
BC110915 mRNA Translation: AAI10916.1 Different initiation.
CCDSiCCDS1846.1 [Q9Y575-1]
CCDS1847.1 [Q9Y575-2]
RefSeqiNP_001157637.1, NM_001164165.1 [Q9Y575-3]
NP_001188894.1, NM_001201965.1 [Q9Y575-2]
NP_057199.1, NM_016115.4 [Q9Y575-1]
NP_665862.1, NM_145863.2 [Q9Y575-2]
UniGeneiHs.40763

3D structure databases

ProteinModelPortaliQ9Y575
SMRiQ9Y575
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119317, 70 interactors
IntActiQ9Y575, 12 interactors
MINTiQ9Y575
STRINGi9606.ENSP00000313756

PTM databases

iPTMnetiQ9Y575
PhosphoSitePlusiQ9Y575

Polymorphism and mutation databases

BioMutaiASB3
DMDMi20532004

Proteomic databases

PaxDbiQ9Y575
PeptideAtlasiQ9Y575
PRIDEiQ9Y575
ProteomicsDBi86306
86307 [Q9Y575-2]

Protocols and materials databases

DNASUi51130
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263634; ENSP00000263634; ENSG00000115239 [Q9Y575-1]
ENST00000394717; ENSP00000378206; ENSG00000115239 [Q9Y575-2]
ENST00000406687; ENSP00000384728; ENSG00000115239 [Q9Y575-2]
GeneIDi100302652
51130
KEGGihsa:100302652
hsa:51130
UCSCiuc002rxg.3 human [Q9Y575-1]

Organism-specific databases

CTDi100302652
51130
EuPathDBiHostDB:ENSG00000115239.21
GeneCardsiASB3
HGNCiHGNC:16013 ASB3
HPAiHPA003940
MIMi605760 gene
neXtProtiNX_Q9Y575
OpenTargetsiENSG00000115239
PharmGKBiPA25031
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0504 Eukaryota
COG0666 LUCA
GeneTreeiENSGT00930000150873
HOGENOMiHOG000022587
HOVERGENiHBG024356
InParanoidiQ9Y575
KOiK10325
OMAiGHEECLE
OrthoDBiEOG091G03ZR
PhylomeDBiQ9Y575
TreeFamiTF315127

Enzyme and pathway databases

UniPathwayi
UPA00143

ReactomeiR-HSA-8951664 Neddylation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

Miscellaneous databases

ChiTaRSiASB3 human
GeneWikiiASB3
PROiPR:Q9Y575
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000115239 Expressed in 89 organ(s), highest expression level in corpus callosum
CleanExiHS_ASB3
ExpressionAtlasiQ9Y575 baseline and differential
GenevisibleiQ9Y575 HS

Family and domain databases

CDDicd00204 ANK, 2 hits
cd03722 SOCS_ASB3, 1 hit
Gene3Di1.25.40.20, 2 hits
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR037329 ASB3_SOCS
IPR001496 SOCS_box
IPR036036 SOCS_box-like_dom_sf
PfamiView protein in Pfam
PF12796 Ank_2, 2 hits
PF13606 Ank_3, 1 hit
PF07525 SOCS_box, 1 hit
PRINTSiPR01415 ANKYRIN
SMARTiView protein in SMART
SM00248 ANK, 10 hits
SM00969 SOCS_box, 1 hit
SUPFAMiSSF158235 SSF158235, 1 hit
SSF48403 SSF48403, 2 hits
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 6 hits
PS50225 SOCS, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiASB3_HUMAN
AccessioniPrimary (citable) accession number: Q9Y575
Secondary accession number(s): B3KPA3
, D6W5B4, D6W5B5, G8JLA9, Q2TAI4, Q53TN0, Q53TN8, Q9NVZ2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2002
Last sequence update: November 1, 1999
Last modified: November 7, 2018
This is version 156 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again