Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - Q9Y4P1 (ATG4B_HUMAN)

Entry version 191 (25 May 2022)
Sequence version 2 (18 May 2010)
Previous versions | rss
Add a publicationFeedback
Protein

Cysteine protease ATG4B

Gene

ATG4B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cysteine protease that plays a key role in autophagy by mediating both proteolytic activation and delipidation of ATG8 family proteins (PubMed:15169837, PubMed:15187094, PubMed:17347651, PubMed:19322194, PubMed:21177865, PubMed:26378241, PubMed:29232556, PubMed:28821708, PubMed:30443548, PubMed:30661429, PubMed:22302004, PubMed:27527864, PubMed:28633005, PubMed:30076329).

Required for canonical autophagy (macroautophagy), non-canonical autophagy as well as for mitophagy (PubMed:33773106, PubMed:33909989).

The protease activity is required for proteolytic activation of ATG8 family proteins: cleaves the C-terminal amino acid of ATG8 proteins MAP1LC3A, MAP1LC3B, MAP1LC3C, GABARAPL1, GABARAPL2 and GABARAP, to reveal a C-terminal glycine (PubMed:15169837, PubMed:15187094, PubMed:17347651, PubMed:20818167, PubMed:19322194, PubMed:21177865, PubMed:22302004, PubMed:27527864, PubMed:28633005, PubMed:29458288, PubMed:30661429, PubMed:28287329).

Exposure of the glycine at the C-terminus is essential for ATG8 proteins conjugation to phosphatidylethanolamine (PE) and insertion to membranes, which is necessary for autophagy (PubMed:15169837, PubMed:15187094, PubMed:17347651, PubMed:19322194, PubMed:21177865, PubMed:22302004).

Protease activity is also required to counteract formation of high-molecular weight conjugates of ATG8 proteins (ATG8ylation): acts as a deubiquitinating-like enzyme that removes ATG8 conjugated to other proteins, such as ATG3 (PubMed:31315929, PubMed:33773106).

In addition to the protease activity, also mediates delipidation of ATG8 family proteins (PubMed:15187094, PubMed:28633005, PubMed:29458288, PubMed:32686895, PubMed:33909989, PubMed:19322194).

Catalyzes delipidation of PE-conjugated forms of ATG8 proteins during macroautophagy (PubMed:15187094, PubMed:29458288, PubMed:32686895, PubMed:33909989, PubMed:19322194).

Also involved in non-canonical autophagy, a parallel pathway involving conjugation of ATG8 proteins to single membranes at endolysosomal compartments, by catalyzing delipidation of ATG8 proteins conjugated to phosphatidylserine (PS) (PubMed:33909989).

Compared to other members of the family (ATG4A, ATG4C or ATG4C), constitutes the major protein for proteolytic activation of ATG8 proteins, while it displays weaker delipidation activity than other ATG4 paralogs (PubMed:29458288, PubMed:30661429).

Involved in phagophore growth during mitophagy independently of its protease activity and of ATG8 proteins: acts by regulating ATG9A trafficking to mitochondria and promoting phagophore-endoplasmic reticulum contacts during the lipid transfer phase of mitophagy (PubMed:33773106).

21 Publications

Caution

A paper describing ATG4B tissue expression has been retracted, due to concerns of image duplication in some of the figures.1 Publication1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by N-ethylmaleimide (PubMed:21177865). Redox-regulated during autophagy since reducing conditions activate ATG4A whereas an oxidizing environment such as the presence of H2O2 inhibits its activity (PubMed:17347651). The cysteine protease activity compounds is inhibited by styrylquinoline compounds 4-28 and LV-320 (PubMed:30076329).3 Publications

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=5.1 µM for MAP1LC3B2 Publications
  2. KM=5.8 µM for GABARAP2 Publications
  3. KM=4.4 µM for GABARAPL12 Publications
  4. KM=6.1 µM for GABARAPL22 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei74Nucleophile8 Publications1
Active sitei278Sequence analysis2 Publications1
Active sitei2802 Publications1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protease, Thiol protease
Biological processAutophagy, Protein transport, Transport, Ubl conjugation pathway

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9Y4P1

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-1632852, Macroautophagy

SABIO-RK: Biochemical Reaction Kinetics Database

More...SABIO-RKi		Q9Y4P1

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q9Y4P1

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q9Y4P1

Protein family/group databases

MEROPS protease database

More...MEROPSi		C54.003

Transport Classification Database

More...TCDBi		9.A.15.2.1, the autophagy-related phagophore-formation transporter (apt) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cysteine protease ATG4BCurated (EC:3.4.22.-2 Publications)
Alternative name(s):
AUT-like 1 cysteine endopeptidase
Autophagy-related cysteine endopeptidase 11 Publication
Short name:
Autophagin-11 Publication
Autophagy-related protein 4 homolog B1 Publication
Short name:
HsAPG4B1 Publication
Short name:
hAPG4B1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ATG4B1 PublicationImported
Synonyms:APG4B1 Publication, AUTL1Imported, KIAA09431 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:20790, ATG4B

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		611338, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9Y4P1

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000168397

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Endoplasmic reticulum, Mitochondrion

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi34S → A: Decreased phosphorylation by AKT2, leading to reduced proteolytic activation of ATG8 family proteins. 1 Publication1
Mutagenesisi34S → D: Phospho-mimetic mutant; increased proteolytic activation of ATG8 family proteins. 1 Publication1
Mutagenesisi74C → S: Complete loss of protease activity. 8 Publications1
Mutagenesisi78C → A: Reduces the redox sensitivity and retains activity in presence of H(2)O(2). 1 Publication1
Mutagenesisi78C → S: Does not affect formation of disulfide bonds. 1 Publication1
Mutagenesisi89C → S: Does not affect formation of disulfide bonds. 1 Publication1
Mutagenesisi121S → A: Decreased phosphorylation by AKT2; when associated with A-262. 1 Publication1
Mutagenesisi142W → A: Strongly reduced protease activity. 1 Publication1
Mutagenesisi183C → S: Does not affect formation of disulfide bonds. 1 Publication1
Mutagenesisi189C → S: Does not affect S-nitrosylation. Strongly decreased S-nitrosylation, leading to increased hydrolase activity and autophagic flux; when associated with S-292. Does not affect formation of disulfide bonds. 2 Publications1
Mutagenesisi203C → S: Does not affect formation of disulfide bonds. 1 Publication1
Mutagenesisi229R → A: Strongly reduced protease activity. 1 Publication1
Mutagenesisi246C → S: Does not affect formation of disulfide bonds. 1 Publication1
Mutagenesisi262S → A: Decreased phosphorylation by AKT2; when associated with A-121. 1 Publication1
Mutagenesisi278D → A: Complete loss of protease activity. 2 Publications1
Mutagenesisi280H → A: Complete loss of protease activity. 2 Publications1
Mutagenesisi292C → S: Does not affect S-nitrosylation. Strongly decreased S-nitrosylation, leading to increased hydrolase activity and autophagic flux; when associated with S-189. Reduced formation of intrachain and interchain disulfide bonds in response to oxidation. Abolished formation of disulfide bonds, leading to increased autophagy; when associated with S-361. 2 Publications1
Mutagenesisi301C → S: Does not affect S-nitrosylation. Does not affect formation of disulfide bonds. 2 Publications1
Mutagenesisi306C → S: Does not affect formation of disulfide bonds. 1 Publication1
Mutagenesisi316S → A: Abolished phosphorylation by ULK1; promotes hydrolase activity, leading to increased proteolytic activation and delipidation of ATG8 family proteins. 1 Publication1
Mutagenesisi316S → D: Phospho-mimetic mutant; reduced hydrolase activity, leading to decreased proteolytic activation and delipidation of ATG8 family proteins. 1 Publication1
Mutagenesisi323C → S: Does not affect formation of disulfide bonds. 1 Publication1
Mutagenesisi333C → S: Does not affect formation of disulfide bonds. 1 Publication1
Mutagenesisi361C → S: Reduced formation of intrachain and interchain disulfide bonds in response to oxidation. Abolished formation of disulfide bonds, leading to increased autophagy; when associated with S-292. 1 Publication1
Mutagenesisi383S → A: Decreased phosphorylation, leading to decreased hydrolase activity and autophagic flux. Does not affect interaction with ATG8 family proteins. 3 Publications1
Mutagenesisi383S → E: Phospho-mimetic mutant; does not affect interaction with ATG8 family proteins. 1 Publication1
Mutagenesisi388 – 391FEIL → AEIA in 2mLIR; decreased interaction with ATG8 family proteins MAP1LC3A, MAP1LC3B and MAP1LC3C. Decreased ability to mediate delipidation of ATG8 proteins conjugated to phosphatidylethanolamine (PE). 2 Publications4
Mutagenesisi392S → A: Decreased phosphorylation, leading to decreased hydrolase activity and autophagic flux. Does not affect interaction with ATG8 family proteins. 2 Publications1
Mutagenesisi392S → E: Phospho-mimetic mutant; slightly increased interaction with ATG8 family proteins. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		23192

Open Targets

More...OpenTargetsi		ENSG00000168397

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134898340

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9Y4P1, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL1741221

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ATG4B

Domain mapping of disease mutations (DMDM)

More...DMDMi		296434400

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002158441 – 393Cysteine protease ATG4BAdd BLAST393

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1 Publication1
Modified residuei34Phosphoserine; by PKB/AKT1 and PKB/AKT23 Publications1
Modified residuei189S-nitrosocysteine1 Publication1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi292 ↔ 3611 Publication
Modified residuei292S-nitrosocysteine1 Publication1
Disulfide bondi292Interchain (with C-361)1 Publication
Modified residuei301S-nitrosocysteine1 Publication1
Modified residuei316Phosphoserine; by ULK11 Publication1
Disulfide bondi361Interchain (with C-292)1 Publication
Modified residuei383Phosphoserine; by STK26Combined sources2 Publications1
Modified residuei392Phosphoserine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation at Ser-383 and Ser-392 promotes autophagy by increasing protein delipidation activity without affecting proteolytic activation of ATG8 proteins (PubMed:26378241). Phosphorylation at Ser-316 by ULK1 inhibits autophagy by decreasing both proteolytic activation and delipidation activities (PubMed:28821708). Phosphorylation at Ser-316 is dephosphorylated by protein phosphatase 2A (PP2A) (PubMed:28821708). Phosphorylation at Ser-34 by AKT2 promotes its hydrolase activity, leading to increased proteolytic activation and delipidation of ATG8 family proteins (PubMed:30443548). Phosphorylation at Ser-34 by AKT1 promotes mitochondrial localization and inhibition of the F1F0-ATP synthase activity, leading to elevation of mitochondrial reactive oxygen species (ROS) (PubMed:29165041).4 Publications
Ubiquitinated by RNF5, leading to its degradation by the proteasome.1 Publication
S-nitrosylation at Cys-189 and Cys-292 in response to high glucose decreases both proteolytic activation and delipidation activities.1 Publication
O-glycosylated by OGT, leading to increase protease activity, thereby promoting the proteolytic activation of ATG8 family proteins.1 Publication
Forms reversible intrachain disulfide bonds in response to oxidative stress (PubMed:31880198). Forms interchain disulfide bonds, leading to formation of homooligomers in response to oxidation (PubMed:31880198).1 Publication

Keywords - PTMi

Acetylation, Disulfide bond, Glycoprotein, Isopeptide bond, Phosphoprotein, S-nitrosylation, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9Y4P1

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9Y4P1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9Y4P1

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9Y4P1

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9Y4P1

PeptideAtlas

More...PeptideAtlasi		Q9Y4P1

PRoteomics IDEntifications database

More...PRIDEi		Q9Y4P1

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		86230 [Q9Y4P1-1]
86231 [Q9Y4P1-2]
86232 [Q9Y4P1-3]
86233 [Q9Y4P1-4]
86234 [Q9Y4P1-6]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q9Y4P1, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9Y4P1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9Y4P1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000168397, Expressed in left lobe of thyroid gland and 237 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9Y4P1, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9Y4P1, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000168397, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PFKP; promoting phosphorylation of ATG4B at Ser-34 (PubMed:33607258).

Interacts with GBP7 (By similarity).

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		116801, 50 interactors

Protein interaction database and analysis system

More...IntActi		Q9Y4P1, 23 interactors

Molecular INTeraction database

More...MINTi		Q9Y4P1

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000384259

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q9Y4P1

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9Y4P1, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1393
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		Q9Y4P1

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9Y4P1

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q9Y4P1

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi388 – 391LIR1 Publication4

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The LIR motif (LC3-interacting region) is required for the interaction with ATG8 family proteins MAP1LC3A, MAP1LC3B, MAP1LC3C and GABARAPL1 (PubMed:28287329). Required for proteolytic activation and delipidation of ATG8 proteins (PubMed:29458288, PubMed:28287329).2 Publications

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase C54 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2674, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00530000063000

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_021259_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9Y4P1

Identification of Orthologs from Complete Genome Data

More...OMAi		CHTRRIR

Database of Orthologous Groups

More...OrthoDBi		431748at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9Y4P1

TreeFam database of animal gene trees

More...TreeFami		TF314847

Family and domain databases

Database of protein disorder

More...DisProti		DP01326

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...IDEALi		IID00347

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR032916, ATG4B_met
IPR038765, Papain-like_cys_pep_sf
IPR005078, Peptidase_C54

The PANTHER Classification System

More...PANTHERi		PTHR22624, PTHR22624, 1 hit
PTHR22624:SF39, PTHR22624:SF39, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF03416, Peptidase_C54, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF54001, SSF54001, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y4P1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDAATLTYDT LRFAEFEDFP ETSEPVWILG RKYSIFTEKD EILSDVASRL 
        60         70         80         90        100
WFTYRKNFPA IGGTGPTSDT GWGCMLRCGQ MIFAQALVCR HLGRDWRWTQ 
       110        120        130        140        150
RKRQPDSYFS VLNAFIDRKD SYYSIHQIAQ MGVGEGKSIG QWYGPNTVAQ 
       160        170        180        190        200
VLKKLAVFDT WSSLAVHIAM DNTVVMEEIR RLCRTSVPCA GATAFPADSD 
       210        220        230        240        250
RHCNGFPAGA EVTNRPSPWR PLVLLIPLRL GLTDINEAYV ETLKHCFMMP 
       260        270        280        290        300
QSLGVIGGKP NSAHYFIGYV GEELIYLDPH TTQPAVEPTD GCFIPDESFH 
       310        320        330        340        350
CQHPPCRMSI AELDPSIAVG FFCKTEDDFN DWCQQVKKLS LLGGALPMFE 
       360        370        380        390 
LVELQPSHLA CPDVLNLSLD SSDVERLERF FDSEDEDFEI LSL
Length:393
Mass (Da):44,294
Last modified:May 18, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF4ADB3192176E0E5
GO
Isoform 2 (identifier: Q9Y4P1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAHSVPSDSR...GSVGGRTGKM
     370-393: DSSDVERLERFFDSEDEDFEILSL → GESCQVQILLM

Show »
Length:468
Mass (Da):52,529
Checksum:iF9731E7C406960D6
GO
Isoform 3 (identifier: Q9Y4P1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-74: Missing.
     321-354: FFCKTEDDFNDWCQQVKKLSLLGGALPMFELVEL → KQGRLVRSLIPWAPRPSSWCAAVLGAAVVMCGTP
     355-393: Missing.

Show »
Length:280
Mass (Da):31,042
Checksum:i0904A795A1B596B3
GO
Isoform 4 (identifier: Q9Y4P1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-74: Missing.
     369-369: L → LGESCQVQVGSLG

Show »
Length:331
Mass (Da):37,037
Checksum:i97592E25838601B2
GO
Isoform 6 (identifier: Q9Y4P1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     370-393: DSSDVERLERFFDSEDEDFEILSL → GESCQVQILLM

Show »
Length:380
Mass (Da):42,622
Checksum:i48140873BCE7533D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J1C1C9J1C1_HUMAN
Cysteine protease
ATG4B
66Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JIK8C9JIK8_HUMAN
Cysteine protease
ATG4B
219Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y2Y0H0Y2Y0_HUMAN
Cysteine protease ATG4B
ATG4B
76Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z2K8F2Z2K8_HUMAN
Cysteine protease ATG4B
ATG4B
88Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA76787 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence BAC86110 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti136Missing in BAB83890 (PubMed:15169837).Curated1
Sequence conflicti188P → L in BAB55127 (PubMed:14702039).Curated1
Sequence conflicti247F → Y in BAB55353 (PubMed:14702039).Curated1
Sequence conflicti273E → G in BAB55042 (PubMed:14702039).Curated1
Sequence conflicti312E → N in BAB83890 (PubMed:15169837).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_021486354L → Q4 PublicationsCorresponds to variant dbSNP:rs7601000Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0130281 – 74Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST74
Alternative sequenceiVSP_0130291M → MAHSVPSDSRTSRRPTTRPH AARGAPRGSRRPGRTPKWRL PRISARAPYRLRRLRRHTYW PPRRPVAASRCWPVGATPLG SVGGRTGKM in isoform 2. 1 Publication1
Alternative sequenceiVSP_013031321 – 354FFCKT…ELVEL → KQGRLVRSLIPWAPRPSSWC AAVLGAAVVMCGTP in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_013032355 – 393Missing in isoform 3. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_013033369L → LGESCQVQVGSLG in isoform 4. 1 Publication1
Alternative sequenceiVSP_013034370 – 393DSSDV…EILSL → GESCQVQILLM in isoform 2 and isoform 6. 1 PublicationAdd BLAST24

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ504652 mRNA Translation: CAD43219.1
AB066215 mRNA Translation: BAB83890.1
AB023160 mRNA Translation: BAA76787.2 Different initiation.
AK027332 mRNA Translation: BAB55042.1
AK027462 mRNA Translation: BAB55127.1
AK027763 mRNA Translation: BAB55353.1
AK125277 mRNA Translation: BAC86110.1 Different initiation.
AL080168 mRNA Translation: CAB45756.1
AC133528 Genomic DNA Translation: AAY14919.1
BC000719 mRNA Translation: AAH00719.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS46564.1 [Q9Y4P1-1]
CCDS46565.1 [Q9Y4P1-6]

Protein sequence database of the Protein Information Resource

More...PIRi		T12492

NCBI Reference Sequences

More...RefSeqi		NP_037457.3, NM_013325.4 [Q9Y4P1-1]
NP_847896.1, NM_178326.2 [Q9Y4P1-6]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000402096.5; ENSP00000384661.1; ENSG00000168397.17 [Q9Y4P1-4]
ENST00000404914.8; ENSP00000384259.3; ENSG00000168397.17
ENST00000405546.7; ENSP00000383964.3; ENSG00000168397.17 [Q9Y4P1-6]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		23192

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:23192

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000404914.8; ENSP00000384259.3; NM_013325.5; NP_037457.3

UCSC genome browser

More...UCSCi		uc002wbv.4, human [Q9Y4P1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ504652 mRNA Translation: CAD43219.1
AB066215 mRNA Translation: BAB83890.1
AB023160 mRNA Translation: BAA76787.2 Different initiation.
AK027332 mRNA Translation: BAB55042.1
AK027462 mRNA Translation: BAB55127.1
AK027763 mRNA Translation: BAB55353.1
AK125277 mRNA Translation: BAC86110.1 Different initiation.
AL080168 mRNA Translation: CAB45756.1
AC133528 Genomic DNA Translation: AAY14919.1
BC000719 mRNA Translation: AAH00719.1
CCDSiCCDS46564.1 [Q9Y4P1-1]
CCDS46565.1 [Q9Y4P1-6]
PIRiT12492
RefSeqiNP_037457.3, NM_013325.4 [Q9Y4P1-1]
NP_847896.1, NM_178326.2 [Q9Y4P1-6]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CY7X-ray1.90A1-393[»]
2D1IX-ray2.00A/B1-393[»]
2Z0DX-ray1.90A1-353[»]
2Z0EX-ray1.90A1-353[»]
2ZZPX-ray2.05A1-353[»]
5LXHX-ray1.58E/F/G384-393[»]
5LXIX-ray1.44C/E384-393[»]
AlphaFoldDBiQ9Y4P1
SMRiQ9Y4P1
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi116801, 50 interactors
IntActiQ9Y4P1, 23 interactors
MINTiQ9Y4P1
STRINGi9606.ENSP00000384259

Chemistry databases

BindingDBiQ9Y4P1
ChEMBLiCHEMBL1741221

Protein family/group databases

MEROPSiC54.003
TCDBi9.A.15.2.1, the autophagy-related phagophore-formation transporter (apt) family

PTM databases

GlyGeniQ9Y4P1, 1 site, 1 O-linked glycan (1 site)
iPTMnetiQ9Y4P1
PhosphoSitePlusiQ9Y4P1

Genetic variation databases

BioMutaiATG4B
DMDMi296434400

Proteomic databases

EPDiQ9Y4P1
jPOSTiQ9Y4P1
MassIVEiQ9Y4P1
MaxQBiQ9Y4P1
PaxDbiQ9Y4P1
PeptideAtlasiQ9Y4P1
PRIDEiQ9Y4P1
ProteomicsDBi86230 [Q9Y4P1-1]
86231 [Q9Y4P1-2]
86232 [Q9Y4P1-3]
86233 [Q9Y4P1-4]
86234 [Q9Y4P1-6]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		12105, 716 antibodies from 41 providers

The DNASU plasmid repository

More...DNASUi		23192

Genome annotation databases

EnsembliENST00000402096.5; ENSP00000384661.1; ENSG00000168397.17 [Q9Y4P1-4]
ENST00000404914.8; ENSP00000384259.3; ENSG00000168397.17
ENST00000405546.7; ENSP00000383964.3; ENSG00000168397.17 [Q9Y4P1-6]
GeneIDi23192
KEGGihsa:23192
MANE-SelectiENST00000404914.8; ENSP00000384259.3; NM_013325.5; NP_037457.3
UCSCiuc002wbv.4, human [Q9Y4P1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		23192
DisGeNETi23192

GeneCards: human genes, protein and diseases

More...GeneCardsi		ATG4B
HGNCiHGNC:20790, ATG4B
HPAiENSG00000168397, Low tissue specificity
MIMi611338, gene
neXtProtiNX_Q9Y4P1
OpenTargetsiENSG00000168397
PharmGKBiPA134898340
VEuPathDBiHostDB:ENSG00000168397

Human Unidentified Gene-Encoded large proteins database

More...HUGEi		Search...

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2674, Eukaryota
GeneTreeiENSGT00530000063000
HOGENOMiCLU_021259_0_1_1
InParanoidiQ9Y4P1
OMAiCHTRRIR
OrthoDBi431748at2759
PhylomeDBiQ9Y4P1
TreeFamiTF314847

Enzyme and pathway databases

PathwayCommonsiQ9Y4P1
ReactomeiR-HSA-1632852, Macroautophagy
SABIO-RKiQ9Y4P1
SignaLinkiQ9Y4P1
SIGNORiQ9Y4P1

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		23192, 14 hits in 1088 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ATG4B, human
EvolutionaryTraceiQ9Y4P1

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		ATG4B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		23192
PharosiQ9Y4P1, Tchem

Protein Ontology

More...PROi		PR:Q9Y4P1
RNActiQ9Y4P1, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000168397, Expressed in left lobe of thyroid gland and 237 other tissues
ExpressionAtlasiQ9Y4P1, baseline and differential
GenevisibleiQ9Y4P1, HS

Family and domain databases

DisProtiDP01326
IDEALiIID00347
InterProiView protein in InterPro
IPR032916, ATG4B_met
IPR038765, Papain-like_cys_pep_sf
IPR005078, Peptidase_C54
PANTHERiPTHR22624, PTHR22624, 1 hit
PTHR22624:SF39, PTHR22624:SF39, 1 hit
PfamiView protein in Pfam
PF03416, Peptidase_C54, 1 hit
SUPFAMiSSF54001, SSF54001, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiATG4B_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y4P1
Secondary accession number(s): B7WNK2
, Q53NU4, Q6ZUV8, Q8WYM9, Q96K07, Q96K96, Q96SZ1, Q9Y2F2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 15, 2005
Last sequence update: May 18, 2010
Last modified: May 25, 2022
This is version 191 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again