Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9Y4P1 (ATG4B_HUMAN)

Entry version 187 (07 Apr 2021)
Sequence version 2 (18 May 2010)
Previous versions | rss
Add a publicationFeedback
Protein

Cysteine protease ATG4B

Gene

ATG4B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Cleaves the C-terminal amino acid of ATG8 family proteins MAP1LC3, GABARAPL1, GABARAPL2 and GABARAP, to reveal a C-terminal glycine. Exposure of the glycine at the C-terminus is essential for ATG8 proteins conjugation to phosphatidylethanolamine (PE) and insertion to membranes, which is necessary for autophagy. Has also an activity of delipidating enzyme for the PE-conjugated forms.6 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by N-ethylmaleimide. Redox-regulated during autophagy since reducing conditions activate ATG4A whereas an oxidizing environment such as the presence of H2O2 inhibits its activity.1 Publication

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=5.1 µM for MAP1LC3B2 Publications
  2. KM=5.8 µM for GABARAP2 Publications
  3. KM=4.4 µM for GABARAPL12 Publications
  4. KM=6.1 µM for GABARAPL22 Publications

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei74Nucleophile4 Publications1
    Active sitei278Sequence analysis2 Publications1
    Active sitei2802 Publications1

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    Complete GO annotation on QuickGO ...

    GO - Biological processi

    Complete GO annotation on QuickGO ...

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionHydrolase, Protease, Thiol protease
    Biological processAutophagy, Protein transport, Transport, Ubl conjugation pathway

    Enzyme and pathway databases

    Pathway Commons web resource for biological pathway data

    More...    PathwayCommonsi    		Q9Y4P1

    Reactome - a knowledgebase of biological pathways and processes

    More...    Reactomei    		R-HSA-1632852, Macroautophagy

    SIGNOR Signaling Network Open Resource

    More...    SIGNORi    		Q9Y4P1

    Protein family/group databases

    MEROPS protease database

    More...    MEROPSi    		C54.003

    Transport Classification Database

    More...    TCDBi    		9.A.15.2.1, the autophagy-related phagophore-formation transporter (apt) family

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Cysteine protease ATG4B (EC:3.4.22.-)
    Alternative name(s):
    AUT-like 1 cysteine endopeptidase
    Autophagin-1
    Autophagy-related cysteine endopeptidase 1
    Autophagy-related protein 4 homolog B
    Short name:
    hAPG4B
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:ATG4B
    Synonyms:APG4B, AUTL1, KIAA0943
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

    Organism-specific databases

    Human Gene Nomenclature Database

    More...    HGNCi    		HGNC:20790, ATG4B

    Online Mendelian Inheritance in Man (OMIM)

    More...    MIMi    		611338, gene

    neXtProt; the human protein knowledge platform

    More...    neXtProti    		NX_Q9Y4P1

    Eukaryotic Pathogen, Vector and Host Database Resources

    More...    VEuPathDBi    		HostDB:ENSG00000168397.16

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Keywords - Cellular componenti

    Cytoplasm

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi74C → S: Complete loss of protease activity. 4 Publications1
    Mutagenesisi78C → A: Reduces the redox sensitivity and retains activity in presence of H(2)O(2). 1 Publication1
    Mutagenesisi142W → A: Strongly reduced protease activity. 1 Publication1
    Mutagenesisi229R → A: Strongly reduced protease activity. 1 Publication1
    Mutagenesisi278D → A: Complete loss of protease activity. 2 Publications1
    Mutagenesisi280H → A: Complete loss of protease activity. 2 Publications1

    Organism-specific databases

    DisGeNET

    More...    DisGeNETi    		23192

    Open Targets

    More...    OpenTargetsi    		ENSG00000168397

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...    PharmGKBi    		PA134898340

    Miscellaneous databases

    Pharos NIH Druggable Genome Knowledgebase

    More...    Pharosi    		Q9Y4P1, Tbio

    Chemistry databases

    ChEMBL database of bioactive drug-like small molecules

    More...    ChEMBLi    		CHEMBL1741221

    Genetic variation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...    BioMutai    		ATG4B

    Domain mapping of disease mutations (DMDM)

    More...    DMDMi    		296434400

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002158441 – 393Cysteine protease ATG4BAdd BLAST393

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1 Publication1
    Modified residuei383PhosphoserineCombined sources1

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...    EPDi    		Q9Y4P1

    jPOST - Japan Proteome Standard Repository/Database

    More...    jPOSTi    		Q9Y4P1

    MassIVE - Mass Spectrometry Interactive Virtual Environment

    More...    MassIVEi    		Q9Y4P1

    PaxDb, a database of protein abundance averages across all three domains of life

    More...    PaxDbi    		Q9Y4P1

    PeptideAtlas

    More...    PeptideAtlasi    		Q9Y4P1

    PRoteomics IDEntifications database

    More...    PRIDEi    		Q9Y4P1

    ProteomicsDB: a multi-organism proteome resource

    More...    ProteomicsDBi    		86230 [Q9Y4P1-1]
    86231 [Q9Y4P1-2]
    86232 [Q9Y4P1-3]
    86233 [Q9Y4P1-4]
    86234 [Q9Y4P1-6]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...    iPTMneti    		Q9Y4P1

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...    PhosphoSitePlusi    		Q9Y4P1

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Mainly expressed in the skeletal muscle, followed by brain, heart, liver and pancreas.2 Publications

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...    Bgeei    		ENSG00000168397, Expressed in left lobe of thyroid gland and 236 other tissues

    ExpressionAtlas, Differential and Baseline Expression

    More...    ExpressionAtlasi    		Q9Y4P1, baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...    Genevisiblei    		Q9Y4P1, HS

    Organism-specific databases

    Human Protein Atlas

    More...    HPAi    		ENSG00000168397, Low tissue specificity

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

    Hide details

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGRID)

    More...    BioGRIDi    		116801, 36 interactors

    Protein interaction database and analysis system

    More...    IntActi    		Q9Y4P1, 23 interactors

    Molecular INTeraction database

    More...    MINTi    		Q9Y4P1

    STRING: functional protein association networks

    More...    STRINGi    		9606.ENSP00000384259

    Chemistry databases

    BindingDB database of measured binding affinities

    More...    BindingDBi    		Q9Y4P1

    Miscellaneous databases

    RNAct, Protein-RNA interaction predictions for model organisms.

    More...    RNActi    		Q9Y4P1, protein

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    Secondary structure

    1393
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...    SMRi    		Q9Y4P1

    Database of comparative protein structure models

    More...    ModBasei    		Search...

    Protein Data Bank in Europe - Knowledge Base

    More...    PDBe-KBi    		Search...

    Miscellaneous databases

    Relative evolutionary importance of amino acids within a protein sequence

    More...    EvolutionaryTracei    		Q9Y4P1

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    <p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the peptidase C54 family.Curated

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...    eggNOGi    		KOG2674, Eukaryota

    Ensembl GeneTree

    More...    GeneTreei    		ENSGT00530000063000

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...    HOGENOMi    		CLU_021259_0_1_1

    InParanoid: Eukaryotic Ortholog Groups

    More...    InParanoidi    		Q9Y4P1

    Identification of Orthologs from Complete Genome Data

    More...    OMAi    		RAPYSIH

    Database of Orthologous Groups

    More...    OrthoDBi    		431748at2759

    Database for complete collections of gene phylogenies

    More...    PhylomeDBi    		Q9Y4P1

    TreeFam database of animal gene trees

    More...    TreeFami    		TF314847

    Family and domain databases

    Database of protein disorder

    More...    DisProti    		DP01326

    Intrinsically Disordered proteins with Extensive Annotations and Literature

    More...    IDEALi    		IID00347

    Integrated resource of protein families, domains and functional sites

    More...    InterProi    		View protein in InterPro
    IPR032916, ATG4B_met
    IPR038765, Papain-like_cys_pep_sf
    IPR005078, Peptidase_C54

    The PANTHER Classification System

    More...    PANTHERi    		PTHR22624, PTHR22624, 1 hit
    PTHR22624:SF39, PTHR22624:SF39, 1 hit

    Pfam protein domain database

    More...    Pfami    		View protein in Pfam
    PF03416, Peptidase_C54, 1 hit

    Superfamily database of structural and functional annotation

    More...    SUPFAMi    		SSF54001, SSF54001, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q9Y4P1-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MDAATLTYDT LRFAEFEDFP ETSEPVWILG RKYSIFTEKD EILSDVASRL 
            60         70         80         90        100
    WFTYRKNFPA IGGTGPTSDT GWGCMLRCGQ MIFAQALVCR HLGRDWRWTQ 
           110        120        130        140        150
    RKRQPDSYFS VLNAFIDRKD SYYSIHQIAQ MGVGEGKSIG QWYGPNTVAQ 
           160        170        180        190        200
    VLKKLAVFDT WSSLAVHIAM DNTVVMEEIR RLCRTSVPCA GATAFPADSD 
           210        220        230        240        250
    RHCNGFPAGA EVTNRPSPWR PLVLLIPLRL GLTDINEAYV ETLKHCFMMP 
           260        270        280        290        300
    QSLGVIGGKP NSAHYFIGYV GEELIYLDPH TTQPAVEPTD GCFIPDESFH 
           310        320        330        340        350
    CQHPPCRMSI AELDPSIAVG FFCKTEDDFN DWCQQVKKLS LLGGALPMFE 
           360        370        380        390 
    LVELQPSHLA CPDVLNLSLD SSDVERLERF FDSEDEDFEI LSL
    Length:393
    Mass (Da):44,294
    Last modified:May 18, 2010 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF4ADB3192176E0E5
    GO
    Isoform 2 (identifier: Q9Y4P1-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MAHSVPSDSR...GSVGGRTGKM
         370-393: DSSDVERLERFFDSEDEDFEILSL → GESCQVQILLM

    Show »
    Length:468
    Mass (Da):52,529
    Checksum:iF9731E7C406960D6
    GO
    Isoform 3 (identifier: Q9Y4P1-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-74: Missing.
         321-354: FFCKTEDDFNDWCQQVKKLSLLGGALPMFELVEL → KQGRLVRSLIPWAPRPSSWCAAVLGAAVVMCGTP
         355-393: Missing.

    Show »
    Length:280
    Mass (Da):31,042
    Checksum:i0904A795A1B596B3
    GO
    Isoform 4 (identifier: Q9Y4P1-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-74: Missing.
         369-369: L → LGESCQVQVGSLG

    Show »
    Length:331
    Mass (Da):37,037
    Checksum:i97592E25838601B2
    GO
    Isoform 6 (identifier: Q9Y4P1-6) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         370-393: DSSDVERLERFFDSEDEDFEILSL → GESCQVQILLM

    Show »
    Length:380
    Mass (Da):42,622
    Checksum:i48140873BCE7533D
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    		Gene namesLengthAnnotation
    C9JIK8C9JIK8_HUMAN
    Cysteine protease
    ATG4B
    		219Annotation score:

    Annotation score:2 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    C9J1C1C9J1C1_HUMAN
    Cysteine protease
    ATG4B
    		66Annotation score:

    Annotation score:2 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H0Y2Y0H0Y2Y0_HUMAN
    Autophagy-related protein 4 homolog...
    ATG4B
    		76Annotation score:

    Annotation score:2 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    F2Z2K8F2Z2K8_HUMAN
    Autophagy-related protein 4 homolog...
    ATG4B
    		88Annotation score:

    Annotation score:2 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    <p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

    The sequence BAA76787 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
    The sequence BAC86110 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti136Missing in BAB83890 (PubMed:15169837).Curated1
    Sequence conflicti188P → L in BAB55127 (PubMed:14702039).Curated1
    Sequence conflicti247F → Y in BAB55353 (PubMed:14702039).Curated1
    Sequence conflicti273E → G in BAB55042 (PubMed:14702039).Curated1
    Sequence conflicti312E → N in BAB83890 (PubMed:15169837).Curated1

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_021486354L → Q5 PublicationsCorresponds to variant dbSNP:rs7601000Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0130281 – 74Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST74
    Alternative sequenceiVSP_0130291M → MAHSVPSDSRTSRRPTTRPH AARGAPRGSRRPGRTPKWRL PRISARAPYRLRRLRRHTYW PPRRPVAASRCWPVGATPLG SVGGRTGKM in isoform 2. 1 Publication1
    Alternative sequenceiVSP_013031321 – 354FFCKT…ELVEL → KQGRLVRSLIPWAPRPSSWC AAVLGAAVVMCGTP in isoform 3. 1 PublicationAdd BLAST34
    Alternative sequenceiVSP_013032355 – 393Missing in isoform 3. 1 PublicationAdd BLAST39
    Alternative sequenceiVSP_013033369L → LGESCQVQVGSLG in isoform 4. 1 Publication1
    Alternative sequenceiVSP_013034370 – 393DSSDV…EILSL → GESCQVQILLM in isoform 2 and isoform 6. 1 PublicationAdd BLAST24

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...    EMBLi

    GenBank nucleotide sequence database

    More...    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...    DDBJi
    Links Updated
    		AJ504652 mRNA Translation: CAD43219.1
    AB066215 mRNA Translation: BAB83890.1
    AB023160 mRNA Translation: BAA76787.2 Different initiation.
    AK027332 mRNA Translation: BAB55042.1
    AK027462 mRNA Translation: BAB55127.1
    AK027763 mRNA Translation: BAB55353.1
    AK125277 mRNA Translation: BAC86110.1 Different initiation.
    AL080168 mRNA Translation: CAB45756.1
    AC133528 Genomic DNA Translation: AAY14919.1
    BC000719 mRNA Translation: AAH00719.1

    The Consensus CDS (CCDS) project

    More...    CCDSi    		CCDS46564.1 [Q9Y4P1-1]
    CCDS46565.1 [Q9Y4P1-6]

    Protein sequence database of the Protein Information Resource

    More...    PIRi    		T12492

    NCBI Reference Sequences

    More...    RefSeqi    		NP_037457.3, NM_013325.4 [Q9Y4P1-1]
    NP_847896.1, NM_178326.2 [Q9Y4P1-6]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...    Ensembli    		ENST00000402096; ENSP00000384661; ENSG00000168397 [Q9Y4P1-4]
    ENST00000404914; ENSP00000384259; ENSG00000168397 [Q9Y4P1-1]
    ENST00000405546; ENSP00000383964; ENSG00000168397 [Q9Y4P1-6]

    Database of genes from NCBI RefSeq genomes

    More...    GeneIDi    		23192

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...    KEGGi    		hsa:23192

    UCSC genome browser

    More...    UCSCi    		uc002wbv.4, human [Q9Y4P1-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    		AJ504652 mRNA Translation: CAD43219.1
    AB066215 mRNA Translation: BAB83890.1
    AB023160 mRNA Translation: BAA76787.2 Different initiation.
    AK027332 mRNA Translation: BAB55042.1
    AK027462 mRNA Translation: BAB55127.1
    AK027763 mRNA Translation: BAB55353.1
    AK125277 mRNA Translation: BAC86110.1 Different initiation.
    AL080168 mRNA Translation: CAB45756.1
    AC133528 Genomic DNA Translation: AAY14919.1
    BC000719 mRNA Translation: AAH00719.1
    CCDSiCCDS46564.1 [Q9Y4P1-1]
    CCDS46565.1 [Q9Y4P1-6]
    PIRiT12492
    RefSeqiNP_037457.3, NM_013325.4 [Q9Y4P1-1]
    NP_847896.1, NM_178326.2 [Q9Y4P1-6]

    3D structure databases

    Select the link destinations:

    Protein Data Bank Europe

    More...    PDBei

    Protein Data Bank RCSB

    More...    RCSB PDBi

    Protein Data Bank Japan

    More...    PDBji
    Links Updated
    		PDB entryMethodResolution (Å)ChainPositionsPDBsum
    2CY7X-ray1.90A1-393[»]
    2D1IX-ray2.00A/B1-393[»]
    2Z0DX-ray1.90A1-353[»]
    2Z0EX-ray1.90A1-353[»]
    2ZZPX-ray2.05A1-353[»]
    5LXHX-ray1.58E/F/G384-393[»]
    5LXIX-ray1.44C/E384-393[»]
    SMRiQ9Y4P1
    ModBaseiSearch...
    PDBe-KBiSearch...

    Protein-protein interaction databases

    BioGRIDi116801, 36 interactors
    IntActiQ9Y4P1, 23 interactors
    MINTiQ9Y4P1
    STRINGi9606.ENSP00000384259

    Chemistry databases

    BindingDBiQ9Y4P1
    ChEMBLiCHEMBL1741221

    Protein family/group databases

    MEROPSiC54.003
    TCDBi9.A.15.2.1, the autophagy-related phagophore-formation transporter (apt) family

    PTM databases

    iPTMnetiQ9Y4P1
    PhosphoSitePlusiQ9Y4P1

    Genetic variation databases

    BioMutaiATG4B
    DMDMi296434400

    Proteomic databases

    EPDiQ9Y4P1
    jPOSTiQ9Y4P1
    MassIVEiQ9Y4P1
    PaxDbiQ9Y4P1
    PeptideAtlasiQ9Y4P1
    PRIDEiQ9Y4P1
    ProteomicsDBi86230 [Q9Y4P1-1]
    86231 [Q9Y4P1-2]
    86232 [Q9Y4P1-3]
    86233 [Q9Y4P1-4]
    86234 [Q9Y4P1-6]

    Protocols and materials databases

    Antibodypedia a portal for validated antibodies

    More...    Antibodypediai    		12105, 700 antibodies

    The DNASU plasmid repository

    More...    DNASUi    		23192

    Genome annotation databases

    EnsembliENST00000402096; ENSP00000384661; ENSG00000168397 [Q9Y4P1-4]
    ENST00000404914; ENSP00000384259; ENSG00000168397 [Q9Y4P1-1]
    ENST00000405546; ENSP00000383964; ENSG00000168397 [Q9Y4P1-6]
    GeneIDi23192
    KEGGihsa:23192
    UCSCiuc002wbv.4, human [Q9Y4P1-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...    CTDi    		23192
    DisGeNETi23192

    GeneCards: human genes, protein and diseases

    More...    GeneCardsi    		ATG4B
    HGNCiHGNC:20790, ATG4B
    HPAiENSG00000168397, Low tissue specificity
    MIMi611338, gene
    neXtProtiNX_Q9Y4P1
    OpenTargetsiENSG00000168397
    PharmGKBiPA134898340
    VEuPathDBiHostDB:ENSG00000168397.16

    Human Unidentified Gene-Encoded large proteins database

    More...    HUGEi    		Search...

    GenAtlas: human gene database

    More...    GenAtlasi    		Search...

    Phylogenomic databases

    eggNOGiKOG2674, Eukaryota
    GeneTreeiENSGT00530000063000
    HOGENOMiCLU_021259_0_1_1
    InParanoidiQ9Y4P1
    OMAiRAPYSIH
    OrthoDBi431748at2759
    PhylomeDBiQ9Y4P1
    TreeFamiTF314847

    Enzyme and pathway databases

    PathwayCommonsiQ9Y4P1
    ReactomeiR-HSA-1632852, Macroautophagy
    SIGNORiQ9Y4P1

    Miscellaneous databases

    BioGRID ORCS database of CRISPR phenotype screens

    More...    BioGRID-ORCSi    		23192, 9 hits in 1005 CRISPR screens

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...    ChiTaRSi    		ATG4B, human
    EvolutionaryTraceiQ9Y4P1

    The Gene Wiki collection of pages on human genes and proteins

    More...    GeneWikii    		ATG4B

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...    GenomeRNAii    		23192
    PharosiQ9Y4P1, Tbio

    Protein Ontology

    More...    PROi    		PR:Q9Y4P1
    RNActiQ9Y4P1, protein

    The Stanford Online Universal Resource for Clones and ESTs

    More...    SOURCEi    		Search...

    Gene expression databases

    BgeeiENSG00000168397, Expressed in left lobe of thyroid gland and 236 other tissues
    ExpressionAtlasiQ9Y4P1, baseline and differential
    GenevisibleiQ9Y4P1, HS

    Family and domain databases

    DisProtiDP01326
    IDEALiIID00347
    InterProiView protein in InterPro
    IPR032916, ATG4B_met
    IPR038765, Papain-like_cys_pep_sf
    IPR005078, Peptidase_C54
    PANTHERiPTHR22624, PTHR22624, 1 hit
    PTHR22624:SF39, PTHR22624:SF39, 1 hit
    PfamiView protein in Pfam
    PF03416, Peptidase_C54, 1 hit
    SUPFAMiSSF54001, SSF54001, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...    ProtoNeti    		Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...    MobiDBi    		Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiATG4B_HUMAN
    <p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y4P1
    Secondary accession number(s): B7WNK2
    , Q53NU4, Q6ZUV8, Q8WYM9, Q96K07, Q96K96, Q96SZ1, Q9Y2F2
    <p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 15, 2005
    Last sequence update: May 18, 2010
    Last modified: April 7, 2021
    This is version 187 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    3D-structure, Direct protein sequencing, Reference proteome

    Documents

    1. Peptidase families
      Classification of peptidase families and list of entries
    2. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    3. Human entries with genetic variants
      List of human entries with genetic variants
    4. Human variants curated from literature reports
      Index of human variants curated from literature reports
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    7. SIMILARITY comments
      Index of protein domains and families
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again