Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - Q9Y4F1 (FARP1_HUMAN)

Entry version 178 (25 May 2022)
Sequence version 1 (01 Nov 1999)
Previous versions | rss
Add a publicationFeedback
Protein

FERM, ARHGEF and pleckstrin domain-containing protein 1

Gene

FARP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Functions as guanine nucleotide exchange factor for RAC1. May play a role in semaphorin signaling. Plays a role in the assembly and disassembly of dendritic filopodia, the formation of dendritic spines, regulation of dendrite length and ultimately the formation of synapses (By similarity).

By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, Guanine-nucleotide releasing factor

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9Y4F1

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-8980692, RHOA GTPase cycle
R-HSA-9013148, CDC42 GTPase cycle
R-HSA-9013149, RAC1 GTPase cycle
R-HSA-9035034, RHOF GTPase cycle

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q9Y4F1

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
FERM, ARHGEF and pleckstrin domain-containing protein 1
Alternative name(s):
Chondrocyte-derived ezrin-like protein
FERM, RhoGEF and pleckstrin domain-containing protein 1
Pleckstrin homology domain-containing family C member 2
Short name:
PH domain-containing family C member 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FARP1
Synonyms:CDEP, PLEKHC2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:3591, FARP1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602654, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9Y4F1

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000152767

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Membrane, Synapse, Synaptosome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		10160

Open Targets

More...OpenTargetsi		ENSG00000152767

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA28004

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9Y4F1, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		FARP1

Domain mapping of disease mutations (DMDM)

More...DMDMi		74762059

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002327531 – 1045FERM, ARHGEF and pleckstrin domain-containing protein 1Add BLAST1045

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei20PhosphoserineBy similarity1
Modified residuei23PhosphoserineBy similarity1
Modified residuei24PhosphothreonineCombined sources1
Modified residuei340PhosphoserineCombined sources1
Modified residuei373PhosphoserineCombined sources1
Modified residuei389PhosphoserineBy similarity1
Modified residuei403PhosphoserineCombined sources1
Modified residuei418PhosphoserineCombined sources1
Modified residuei427PhosphoserineCombined sources1
Modified residuei433PhosphoserineBy similarity1
Modified residuei510PhosphoserineCombined sources1
Modified residuei514PhosphoserineCombined sources1
Modified residuei833PhosphoserineCombined sources1
Modified residuei872PhosphoserineCombined sources1
Modified residuei878PhosphoserineBy similarity1
Modified residuei883PhosphothreonineCombined sources1
Modified residuei889PhosphoserineCombined sources1
Modified residuei896PhosphoserineBy similarity1
Modified residuei899PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9Y4F1

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9Y4F1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9Y4F1

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9Y4F1

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9Y4F1

PeptideAtlas

More...PeptideAtlasi		Q9Y4F1

PRoteomics IDEntifications database

More...PRIDEi		Q9Y4F1

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		86186 [Q9Y4F1-1]
86187 [Q9Y4F1-2]
86188 [Q9Y4F1-3]

PTM databases

CarbonylDB database of protein carbonylation sites

More...CarbonylDBi		Q9Y4F1

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9Y4F1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9Y4F1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in cAMP-treated chondrocytes, but not in untreated chondrocytes. Detected in fetal brain, heart and spleen, and in adult testis, kidney and lung.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated in response to cAMP in cultured embryonic chondrocytes.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000152767, Expressed in adrenal tissue and 235 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9Y4F1, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9Y4F1, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000152767, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CADM1.

Interacts with RAC1 (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		115462, 111 interactors

Protein interaction database and analysis system

More...IntActi		Q9Y4F1, 54 interactors

Molecular INTeraction database

More...MINTi		Q9Y4F1

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000471242

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9Y4F1, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		Q9Y4F1

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9Y4F1

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini40 – 320FERMPROSITE-ProRule annotationAdd BLAST281
Domaini540 – 730DHPROSITE-ProRule annotationAdd BLAST191
Domaini759 – 856PH 1PROSITE-ProRule annotationAdd BLAST98
Domaini932 – 1029PH 2PROSITE-ProRule annotationAdd BLAST98

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 37DisorderedSequence analysisAdd BLAST37
Regioni361 – 534DisorderedSequence analysisAdd BLAST174
Regioni864 – 903DisorderedSequence analysisAdd BLAST40

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi16 – 30Polar residuesSequence analysisAdd BLAST15
Compositional biasi371 – 401Polar residuesSequence analysisAdd BLAST31
Compositional biasi460 – 515Polar residuesSequence analysisAdd BLAST56

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Intramolecular interaction between the DH domain and the PH domains can stabilize the protein in an autoinhibited conformation.1 Publication

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3531, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155318

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_012301_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9Y4F1

Database of Orthologous Groups

More...OrthoDBi		476668at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9Y4F1

TreeFam database of animal gene trees

More...TreeFami		TF351276

Family and domain databases

Conserved Domains Database

More...CDDi		cd14473, FERM_B-lobe, 1 hit
cd13193, FERM_C_FARP1-like, 1 hit
cd00160, RhoGEF, 1 hit

Database of protein disorder

More...DisProti		DP02833

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.20.80.10, 1 hit
1.20.900.10, 1 hit
2.30.29.30, 3 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR019749, Band_41_domain
IPR035899, DBL_dom_sf
IPR000219, DH-domain
IPR000798, Ez/rad/moesin-like
IPR041788, FARP1/FARP2/FRMD7_FERM_C
IPR014847, FERM-adjacent
IPR014352, FERM/acyl-CoA-bd_prot_sf
IPR035963, FERM_2
IPR019748, FERM_central
IPR019747, FERM_CS
IPR000299, FERM_domain
IPR018979, FERM_N
IPR018980, FERM_PH-like_C
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR029071, Ubiquitin-like_domsf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF08736, FA, 1 hit
PF09380, FERM_C, 1 hit
PF00373, FERM_M, 1 hit
PF09379, FERM_N, 1 hit
PF00169, PH, 2 hits
PF00621, RhoGEF, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00935, BAND41
PR00661, ERMFAMILY

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00295, B41, 1 hit
SM01195, FA, 1 hit
SM01196, FERM_C, 1 hit
SM00233, PH, 2 hits
SM00325, RhoGEF, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47031, SSF47031, 1 hit
SSF48065, SSF48065, 1 hit
SSF54236, SSF54236, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50010, DH_2, 1 hit
PS00660, FERM_1, 1 hit
PS50057, FERM_3, 1 hit
PS50003, PH_DOMAIN, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y4F1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGEIEQRPTP GSRLGAPENS GISTLERGQK PPPTPSGKLV SIKIQMLDDT 
        60         70         80         90        100
QEAFEVPQRA PGKVLLDAVC NHLNLVEGDY FGLEFPDHKK ITVWLDLLKP 
       110        120        130        140        150
IVKQIRRPKH VVVKFVVKFF PPDHTQLQEE LTRYLFALQV KQDLAQGRLT 
       160        170        180        190        200
CNDTSAALLI SHIVQSEIGD FDEALDREHL AKNKYIPQQD ALEDKIVEFH 
       210        220        230        240        250
HNHIGQTPAE SDFQLLEIAR RLEMYGIRLH PAKDREGTKI NLAVANTGIL 
       260        270        280        290        300
VFQGFTKINA FNWAKVRKLS FKRKRFLIKL RPDANSAYQD TLEFLMASRD 
       310        320        330        340        350
FCKSFWKICV EHHAFFRLFE EPKPKPKPVL FSRGSSFRFS GRTQKQVLDY 
       360        370        380        390        400
VKEGGHKKVQ FERKHSKIHS IRSLASQPTE LNSEVLEQSQ QSTSLTFGEG 
       410        420        430        440        450
AESPGGQSCR RGKEPKVSAG EPGSHPSPAP RRSPAGNKQA DGAASAPTEE 
       460        470        480        490        500
EEEVVKDRTQ QSKPQPPQPS TGSLTGSPHL SELSVNSQGG VAPANVTLSP 
       510        520        530        540        550
NLSPDTKQAS PLISPLLNDQ ACPRTDDEDE GRRKRFPTDK AYFIAKEVST 
       560        570        580        590        600
TERTYLKDLE VITSWFQSTV SKEDAMPEAL KSLIFPNFEP LHKFHTNFLK 
       610        620        630        640        650
EIEQRLALWE GRSNAQIRDY QRIGDVMLKN IQGMKHLAAH LWKHSEALEA 
       660        670        680        690        700
LENGIKSSRR LENFCRDFEL QKVCYLPLNT FLLRPLHRLM HYKQVLERLC 
       710        720        730        740        750
KHHPPSHADF RDCRAALAEI TEMVAQLHGT MIKMENFQKL HELKKDLIGI 
       760        770        780        790        800
DNLVVPGREF IRLGSLSKLS GKGLQQRMFF LFNDVLLYTS RGLTASNQFK 
       810        820        830        840        850
VHGQLPLYGM TIEESEDEWG VPHCLTLRGQ RQSIIVAASS RSEMEKWVED 
       860        870        880        890        900
IQMAIDLAEK SSSPAPEFLA SSPPDNKSPD EATAADQESE DDLSASRTSL 
       910        920        930        940        950
ERQAPHRGNT MVHVCWHRNT SVSMVDFSIA VENQLSGNLL RKFKNSNGWQ 
       960        970        980        990       1000
KLWVVFTNFC LFFYKSHQDN HPLASLPLLG YSLTIPSESE NIQKDYVFKL 
      1010       1020       1030       1040 
HFKSHVYYFR AESEYTFERW MEVIRSATSS ASRPHVLSHK ESLVY
Length:1,045
Mass (Da):118,633
Last modified:November 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0E8B2D61C0F58417
GO
Isoform 2 (identifier: Q9Y4F1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     758-758: R → RPGSFSLMRTPHLGQARRIPCAPERRPLLLVK

Show »
Length:1,076
Mass (Da):122,113
Checksum:i25A71B2C8C60A280
GO
Isoform 3 (identifier: Q9Y4F1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-129: QRAPGKVLLD...FPPDHTQLQE → MVSSSSFLKA...TVTEELLNLF
     130-1045: Missing.

Show »
Length:129
Mass (Da):14,138
Checksum:iED33383FA354AB1E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JME2C9JME2_HUMAN
FERM, ARHGEF and pleckstrin domain-...
FARP1
1,076Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GV68A0A1B0GV68_HUMAN
FERM, ARHGEF and pleckstrin domain-...
FARP1
801Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QYB0M0QYB0_HUMAN
FERM, ARHGEF and pleckstrin domain-...
FARP1
203Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QXT1M0QXT1_HUMAN
FERM, ARHGEF and pleckstrin domain-...
FARP1
248Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R262M0R262_HUMAN
FERM, ARHGEF and pleckstrin domain-...
FARP1
171Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y783H0Y783_HUMAN
FERM, ARHGEF and pleckstrin domain-...
FARP1
215Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti644H → Y in AAH71592 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0483628P → L. Corresponds to variant dbSNP:rs9300466Ensembl.1
Natural variantiVAR_035851714R → L in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs1458028855Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04098958 – 129QRAPG…TQLQE → MVSSSSFLKATGSSWTGWVL RCSMKPKHHSHLIEKFGEDR ILTHLTGSISYTNWAGSRSL AVTVTEELLNLF in isoform 3. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_040990130 – 1045Missing in isoform 3. 1 PublicationAdd BLAST916
Alternative sequenceiVSP_017976758R → RPGSFSLMRTPHLGQARRIP CAPERRPLLLVK in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB008430 mRNA Translation: BAA24267.1
AL136300 Genomic DNA No translation available.
AL137249 Genomic DNA No translation available.
AL161896 Genomic DNA No translation available.
AL445223 Genomic DNA No translation available.
BC041595 mRNA Translation: AAH41595.1
BC065020 mRNA No translation available.
BC071592 mRNA Translation: AAH71592.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS32000.1 [Q9Y4F1-3]
CCDS66572.1 [Q9Y4F1-2]
CCDS9487.1 [Q9Y4F1-1]

Protein sequence database of the Protein Information Resource

More...PIRi		JC5795

NCBI Reference Sequences

More...RefSeqi		NP_001001715.2, NM_001001715.3 [Q9Y4F1-3]
NP_001273768.1, NM_001286839.1
NP_005757.1, NM_005766.3 [Q9Y4F1-1]
XP_016875801.1, XM_017020312.1 [Q9Y4F1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000319562.11; ENSP00000322926.6; ENSG00000152767.17
ENST00000376581.9; ENSP00000365765.4; ENSG00000152767.17 [Q9Y4F1-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		10160

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:10160

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000319562.11; ENSP00000322926.6; NM_005766.4; NP_005757.1

UCSC genome browser

More...UCSCi		uc001vni.5, human [Q9Y4F1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB008430 mRNA Translation: BAA24267.1
AL136300 Genomic DNA No translation available.
AL137249 Genomic DNA No translation available.
AL161896 Genomic DNA No translation available.
AL445223 Genomic DNA No translation available.
BC041595 mRNA Translation: AAH41595.1
BC065020 mRNA No translation available.
BC071592 mRNA Translation: AAH71592.1
CCDSiCCDS32000.1 [Q9Y4F1-3]
CCDS66572.1 [Q9Y4F1-2]
CCDS9487.1 [Q9Y4F1-1]
PIRiJC5795
RefSeqiNP_001001715.2, NM_001001715.3 [Q9Y4F1-3]
NP_001273768.1, NM_001286839.1
NP_005757.1, NM_005766.3 [Q9Y4F1-1]
XP_016875801.1, XM_017020312.1 [Q9Y4F1-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4H6YX-ray4.09A/B539-1035[»]
AlphaFoldDBiQ9Y4F1
SMRiQ9Y4F1
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi115462, 111 interactors
IntActiQ9Y4F1, 54 interactors
MINTiQ9Y4F1
STRINGi9606.ENSP00000471242

PTM databases

CarbonylDBiQ9Y4F1
iPTMnetiQ9Y4F1
PhosphoSitePlusiQ9Y4F1

Genetic variation databases

BioMutaiFARP1
DMDMi74762059

Proteomic databases

EPDiQ9Y4F1
jPOSTiQ9Y4F1
MassIVEiQ9Y4F1
MaxQBiQ9Y4F1
PaxDbiQ9Y4F1
PeptideAtlasiQ9Y4F1
PRIDEiQ9Y4F1
ProteomicsDBi86186 [Q9Y4F1-1]
86187 [Q9Y4F1-2]
86188 [Q9Y4F1-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		619, 215 antibodies from 20 providers

The DNASU plasmid repository

More...DNASUi		10160

Genome annotation databases

EnsembliENST00000319562.11; ENSP00000322926.6; ENSG00000152767.17
ENST00000376581.9; ENSP00000365765.4; ENSG00000152767.17 [Q9Y4F1-3]
GeneIDi10160
KEGGihsa:10160
MANE-SelectiENST00000319562.11; ENSP00000322926.6; NM_005766.4; NP_005757.1
UCSCiuc001vni.5, human [Q9Y4F1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		10160
DisGeNETi10160

GeneCards: human genes, protein and diseases

More...GeneCardsi		FARP1
HGNCiHGNC:3591, FARP1
HPAiENSG00000152767, Low tissue specificity
MIMi602654, gene
neXtProtiNX_Q9Y4F1
OpenTargetsiENSG00000152767
PharmGKBiPA28004
VEuPathDBiHostDB:ENSG00000152767

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3531, Eukaryota
GeneTreeiENSGT00940000155318
HOGENOMiCLU_012301_0_0_1
InParanoidiQ9Y4F1
OrthoDBi476668at2759
PhylomeDBiQ9Y4F1
TreeFamiTF351276

Enzyme and pathway databases

PathwayCommonsiQ9Y4F1
ReactomeiR-HSA-8980692, RHOA GTPase cycle
R-HSA-9013148, CDC42 GTPase cycle
R-HSA-9013149, RAC1 GTPase cycle
R-HSA-9035034, RHOF GTPase cycle
SignaLinkiQ9Y4F1

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		10160, 14 hits in 1069 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		FARP1, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		FARP1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		10160
PharosiQ9Y4F1, Tbio

Protein Ontology

More...PROi		PR:Q9Y4F1
RNActiQ9Y4F1, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000152767, Expressed in adrenal tissue and 235 other tissues
ExpressionAtlasiQ9Y4F1, baseline and differential
GenevisibleiQ9Y4F1, HS

Family and domain databases

CDDicd14473, FERM_B-lobe, 1 hit
cd13193, FERM_C_FARP1-like, 1 hit
cd00160, RhoGEF, 1 hit
DisProtiDP02833
Gene3Di1.20.80.10, 1 hit
1.20.900.10, 1 hit
2.30.29.30, 3 hits
InterProiView protein in InterPro
IPR019749, Band_41_domain
IPR035899, DBL_dom_sf
IPR000219, DH-domain
IPR000798, Ez/rad/moesin-like
IPR041788, FARP1/FARP2/FRMD7_FERM_C
IPR014847, FERM-adjacent
IPR014352, FERM/acyl-CoA-bd_prot_sf
IPR035963, FERM_2
IPR019748, FERM_central
IPR019747, FERM_CS
IPR000299, FERM_domain
IPR018979, FERM_N
IPR018980, FERM_PH-like_C
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR029071, Ubiquitin-like_domsf
PfamiView protein in Pfam
PF08736, FA, 1 hit
PF09380, FERM_C, 1 hit
PF00373, FERM_M, 1 hit
PF09379, FERM_N, 1 hit
PF00169, PH, 2 hits
PF00621, RhoGEF, 1 hit
PRINTSiPR00935, BAND41
PR00661, ERMFAMILY
SMARTiView protein in SMART
SM00295, B41, 1 hit
SM01195, FA, 1 hit
SM01196, FERM_C, 1 hit
SM00233, PH, 2 hits
SM00325, RhoGEF, 1 hit
SUPFAMiSSF47031, SSF47031, 1 hit
SSF48065, SSF48065, 1 hit
SSF54236, SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50010, DH_2, 1 hit
PS00660, FERM_1, 1 hit
PS50057, FERM_3, 1 hit
PS50003, PH_DOMAIN, 2 hits

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFARP1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y4F1
Secondary accession number(s): Q5JVI9, Q6IQ29
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 18, 2006
Last sequence update: November 1, 1999
Last modified: May 25, 2022
This is version 178 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again