Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

FERM, ARHGEF and pleckstrin domain-containing protein 1

Gene

FARP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Functions as guanine nucleotide exchange factor for RAC1. May play a role in semaphorin signaling. Plays a role in the assembly and disassembly of dendritic filopodia, the formation of dendritic spines, regulation of dendrite length and ultimately the formation of synapses (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein, Guanine-nucleotide releasing factor

Names & Taxonomyi

Protein namesi
Recommended name:
FERM, ARHGEF and pleckstrin domain-containing protein 1
Alternative name(s):
Chondrocyte-derived ezrin-like protein
FERM, RhoGEF and pleckstrin domain-containing protein 1
Pleckstrin homology domain-containing family C member 2
Short name:
PH domain-containing family C member 2
Gene namesi
Name:FARP1
Synonyms:CDEP, PLEKHC2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

EuPathDBiHostDB:ENSG00000152767.15
HGNCiHGNC:3591 FARP1
MIMi602654 gene
neXtProtiNX_Q9Y4F1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Membrane, Synapse, Synaptosome

Pathology & Biotechi

Organism-specific databases

DisGeNETi10160
OpenTargetsiENSG00000152767
PharmGKBiPA28004

Polymorphism and mutation databases

BioMutaiFARP1
DMDMi74762059

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002327531 – 1045FERM, ARHGEF and pleckstrin domain-containing protein 1Add BLAST1045

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei20PhosphoserineBy similarity1
Modified residuei23PhosphoserineBy similarity1
Modified residuei24PhosphothreonineCombined sources1
Modified residuei340PhosphoserineCombined sources1
Modified residuei373PhosphoserineCombined sources1
Modified residuei389PhosphoserineBy similarity1
Modified residuei403PhosphoserineCombined sources1
Modified residuei418PhosphoserineCombined sources1
Modified residuei427PhosphoserineCombined sources1
Modified residuei433PhosphoserineBy similarity1
Modified residuei510PhosphoserineCombined sources1
Modified residuei514PhosphoserineCombined sources1
Modified residuei833PhosphoserineCombined sources1
Modified residuei872PhosphoserineCombined sources1
Modified residuei878PhosphoserineBy similarity1
Modified residuei883PhosphothreonineCombined sources1
Modified residuei889PhosphoserineCombined sources1
Modified residuei896PhosphoserineBy similarity1
Modified residuei899PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9Y4F1
PaxDbiQ9Y4F1
PeptideAtlasiQ9Y4F1
PRIDEiQ9Y4F1
ProteomicsDBi86186
86187 [Q9Y4F1-2]
86188 [Q9Y4F1-3]

PTM databases

CarbonylDBiQ9Y4F1
iPTMnetiQ9Y4F1
PhosphoSitePlusiQ9Y4F1

Expressioni

Tissue specificityi

Detected in cAMP-treated chondrocytes, but not in untreated chondrocytes. Detected in fetal brain, heart and spleen, and in adult testis, kidney and lung.1 Publication

Inductioni

Up-regulated in response to cAMP in cultured embryonic chondrocytes.1 Publication

Gene expression databases

BgeeiENSG00000152767 Expressed in 226 organ(s), highest expression level in adrenal tissue
CleanExiHS_FARP1
ExpressionAtlasiQ9Y4F1 baseline and differential
GenevisibleiQ9Y4F1 HS

Organism-specific databases

HPAiHPA000760

Interactioni

Subunit structurei

Interacts with CADM1. Interacts with RAC1 (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi115462, 34 interactors
IntActiQ9Y4F1, 29 interactors
MINTiQ9Y4F1
STRINGi9606.ENSP00000322926

Structurei

3D structure databases

ProteinModelPortaliQ9Y4F1
SMRiQ9Y4F1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini40 – 320FERMPROSITE-ProRule annotationAdd BLAST281
Domaini540 – 730DHPROSITE-ProRule annotationAdd BLAST191
Domaini759 – 856PH 1PROSITE-ProRule annotationAdd BLAST98
Domaini932 – 1029PH 2PROSITE-ProRule annotationAdd BLAST98

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi449 – 453Poly-Glu5

Domaini

Intramolecular interaction between the DH domain and the PH domains can stabilize the protein in an autoinhibited conformation.1 Publication

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG3531 Eukaryota
ENOG410XP7Q LUCA
GeneTreeiENSGT00920000148976
HOGENOMiHOG000007957
HOVERGENiHBG081521
InParanoidiQ9Y4F1
KOiK17477
PhylomeDBiQ9Y4F1
TreeFamiTF351276

Family and domain databases

CDDicd14473 FERM_B-lobe, 1 hit
cd00160 RhoGEF, 1 hit
Gene3Di1.20.80.10, 1 hit
1.20.900.10, 1 hit
2.30.29.30, 2 hits
InterProiView protein in InterPro
IPR019749 Band_41_domain
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR000798 Ez/rad/moesin-like
IPR014847 FERM-adjacent
IPR014352 FERM/acyl-CoA-bd_prot_sf
IPR035963 FERM_2
IPR019748 FERM_central
IPR019747 FERM_CS
IPR000299 FERM_domain
IPR018979 FERM_N
IPR018980 FERM_PH-like_C
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR029071 Ubiquitin-like_domsf
PfamiView protein in Pfam
PF08736 FA, 1 hit
PF09380 FERM_C, 1 hit
PF00373 FERM_M, 1 hit
PF09379 FERM_N, 1 hit
PF00169 PH, 2 hits
PF00621 RhoGEF, 1 hit
PRINTSiPR00935 BAND41
PR00661 ERMFAMILY
SMARTiView protein in SMART
SM00295 B41, 1 hit
SM01195 FA, 1 hit
SM01196 FERM_C, 1 hit
SM00233 PH, 2 hits
SM00325 RhoGEF, 1 hit
SUPFAMiSSF47031 SSF47031, 1 hit
SSF48065 SSF48065, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50010 DH_2, 1 hit
PS00660 FERM_1, 1 hit
PS50057 FERM_3, 1 hit
PS50003 PH_DOMAIN, 2 hits

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y4F1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGEIEQRPTP GSRLGAPENS GISTLERGQK PPPTPSGKLV SIKIQMLDDT
60 70 80 90 100
QEAFEVPQRA PGKVLLDAVC NHLNLVEGDY FGLEFPDHKK ITVWLDLLKP
110 120 130 140 150
IVKQIRRPKH VVVKFVVKFF PPDHTQLQEE LTRYLFALQV KQDLAQGRLT
160 170 180 190 200
CNDTSAALLI SHIVQSEIGD FDEALDREHL AKNKYIPQQD ALEDKIVEFH
210 220 230 240 250
HNHIGQTPAE SDFQLLEIAR RLEMYGIRLH PAKDREGTKI NLAVANTGIL
260 270 280 290 300
VFQGFTKINA FNWAKVRKLS FKRKRFLIKL RPDANSAYQD TLEFLMASRD
310 320 330 340 350
FCKSFWKICV EHHAFFRLFE EPKPKPKPVL FSRGSSFRFS GRTQKQVLDY
360 370 380 390 400
VKEGGHKKVQ FERKHSKIHS IRSLASQPTE LNSEVLEQSQ QSTSLTFGEG
410 420 430 440 450
AESPGGQSCR RGKEPKVSAG EPGSHPSPAP RRSPAGNKQA DGAASAPTEE
460 470 480 490 500
EEEVVKDRTQ QSKPQPPQPS TGSLTGSPHL SELSVNSQGG VAPANVTLSP
510 520 530 540 550
NLSPDTKQAS PLISPLLNDQ ACPRTDDEDE GRRKRFPTDK AYFIAKEVST
560 570 580 590 600
TERTYLKDLE VITSWFQSTV SKEDAMPEAL KSLIFPNFEP LHKFHTNFLK
610 620 630 640 650
EIEQRLALWE GRSNAQIRDY QRIGDVMLKN IQGMKHLAAH LWKHSEALEA
660 670 680 690 700
LENGIKSSRR LENFCRDFEL QKVCYLPLNT FLLRPLHRLM HYKQVLERLC
710 720 730 740 750
KHHPPSHADF RDCRAALAEI TEMVAQLHGT MIKMENFQKL HELKKDLIGI
760 770 780 790 800
DNLVVPGREF IRLGSLSKLS GKGLQQRMFF LFNDVLLYTS RGLTASNQFK
810 820 830 840 850
VHGQLPLYGM TIEESEDEWG VPHCLTLRGQ RQSIIVAASS RSEMEKWVED
860 870 880 890 900
IQMAIDLAEK SSSPAPEFLA SSPPDNKSPD EATAADQESE DDLSASRTSL
910 920 930 940 950
ERQAPHRGNT MVHVCWHRNT SVSMVDFSIA VENQLSGNLL RKFKNSNGWQ
960 970 980 990 1000
KLWVVFTNFC LFFYKSHQDN HPLASLPLLG YSLTIPSESE NIQKDYVFKL
1010 1020 1030 1040
HFKSHVYYFR AESEYTFERW MEVIRSATSS ASRPHVLSHK ESLVY
Length:1,045
Mass (Da):118,633
Last modified:November 1, 1999 - v1
Checksum:i0E8B2D61C0F58417
GO
Isoform 2 (identifier: Q9Y4F1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     758-758: R → RPGSFSLMRTPHLGQARRIPCAPERRPLLLVK

Note: No experimental confirmation available.
Show »
Length:1,076
Mass (Da):122,113
Checksum:i25A71B2C8C60A280
GO
Isoform 3 (identifier: Q9Y4F1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-129: QRAPGKVLLD...FPPDHTQLQE → MVSSSSFLKA...TVTEELLNLF
     130-1045: Missing.

Show »
Length:129
Mass (Da):14,138
Checksum:iED33383FA354AB1E
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JME2C9JME2_HUMAN
FERM, ARHGEF and pleckstrin domain-...
FARP1
1,076Annotation score:
M0QYB0M0QYB0_HUMAN
FERM, ARHGEF and pleckstrin domain-...
FARP1
203Annotation score:
H0Y783H0Y783_HUMAN
FERM, ARHGEF and pleckstrin domain-...
FARP1
215Annotation score:
M0QXT1M0QXT1_HUMAN
FERM, ARHGEF and pleckstrin domain-...
FARP1
248Annotation score:
A0A1B0GV68A0A1B0GV68_HUMAN
FERM, ARHGEF and pleckstrin domain-...
FARP1
801Annotation score:
M0R262M0R262_HUMAN
FERM, ARHGEF and pleckstrin domain-...
FARP1
171Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti644H → Y in AAH71592 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0483628P → L. Corresponds to variant dbSNP:rs9300466Ensembl.1
Natural variantiVAR_035851714R → L in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs1458028855Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04098958 – 129QRAPG…TQLQE → MVSSSSFLKATGSSWTGWVL RCSMKPKHHSHLIEKFGEDR ILTHLTGSISYTNWAGSRSL AVTVTEELLNLF in isoform 3. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_040990130 – 1045Missing in isoform 3. 1 PublicationAdd BLAST916
Alternative sequenceiVSP_017976758R → RPGSFSLMRTPHLGQARRIP CAPERRPLLLVK in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB008430 mRNA Translation: BAA24267.1
AL136300 Genomic DNA No translation available.
AL137249 Genomic DNA No translation available.
AL161896 Genomic DNA No translation available.
AL445223 Genomic DNA No translation available.
BC041595 mRNA Translation: AAH41595.1
BC065020 mRNA No translation available.
BC071592 mRNA Translation: AAH71592.1
CCDSiCCDS32000.1 [Q9Y4F1-3]
CCDS66572.1 [Q9Y4F1-2]
CCDS9487.1 [Q9Y4F1-1]
PIRiJC5795
RefSeqiNP_001001715.2, NM_001001715.3 [Q9Y4F1-3]
NP_001273768.1, NM_001286839.1
NP_005757.1, NM_005766.3 [Q9Y4F1-1]
XP_016875801.1, XM_017020312.1 [Q9Y4F1-1]
UniGeneiHs.403917
Hs.709933
Hs.729583

Genome annotation databases

EnsembliENST00000319562; ENSP00000322926; ENSG00000152767 [Q9Y4F1-1]
ENST00000376581; ENSP00000365765; ENSG00000152767 [Q9Y4F1-3]
GeneIDi10160
KEGGihsa:10160
UCSCiuc001vni.5 human [Q9Y4F1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB008430 mRNA Translation: BAA24267.1
AL136300 Genomic DNA No translation available.
AL137249 Genomic DNA No translation available.
AL161896 Genomic DNA No translation available.
AL445223 Genomic DNA No translation available.
BC041595 mRNA Translation: AAH41595.1
BC065020 mRNA No translation available.
BC071592 mRNA Translation: AAH71592.1
CCDSiCCDS32000.1 [Q9Y4F1-3]
CCDS66572.1 [Q9Y4F1-2]
CCDS9487.1 [Q9Y4F1-1]
PIRiJC5795
RefSeqiNP_001001715.2, NM_001001715.3 [Q9Y4F1-3]
NP_001273768.1, NM_001286839.1
NP_005757.1, NM_005766.3 [Q9Y4F1-1]
XP_016875801.1, XM_017020312.1 [Q9Y4F1-1]
UniGeneiHs.403917
Hs.709933
Hs.729583

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4H6YX-ray4.09A/B539-1035[»]
ProteinModelPortaliQ9Y4F1
SMRiQ9Y4F1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115462, 34 interactors
IntActiQ9Y4F1, 29 interactors
MINTiQ9Y4F1
STRINGi9606.ENSP00000322926

PTM databases

CarbonylDBiQ9Y4F1
iPTMnetiQ9Y4F1
PhosphoSitePlusiQ9Y4F1

Polymorphism and mutation databases

BioMutaiFARP1
DMDMi74762059

Proteomic databases

EPDiQ9Y4F1
PaxDbiQ9Y4F1
PeptideAtlasiQ9Y4F1
PRIDEiQ9Y4F1
ProteomicsDBi86186
86187 [Q9Y4F1-2]
86188 [Q9Y4F1-3]

Protocols and materials databases

DNASUi10160
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000319562; ENSP00000322926; ENSG00000152767 [Q9Y4F1-1]
ENST00000376581; ENSP00000365765; ENSG00000152767 [Q9Y4F1-3]
GeneIDi10160
KEGGihsa:10160
UCSCiuc001vni.5 human [Q9Y4F1-1]

Organism-specific databases

CTDi10160
DisGeNETi10160
EuPathDBiHostDB:ENSG00000152767.15
GeneCardsiFARP1
HGNCiHGNC:3591 FARP1
HPAiHPA000760
MIMi602654 gene
neXtProtiNX_Q9Y4F1
OpenTargetsiENSG00000152767
PharmGKBiPA28004
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3531 Eukaryota
ENOG410XP7Q LUCA
GeneTreeiENSGT00920000148976
HOGENOMiHOG000007957
HOVERGENiHBG081521
InParanoidiQ9Y4F1
KOiK17477
PhylomeDBiQ9Y4F1
TreeFamiTF351276

Miscellaneous databases

ChiTaRSiFARP1 human
GeneWikiiFARP1
GenomeRNAii10160
PROiPR:Q9Y4F1
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000152767 Expressed in 226 organ(s), highest expression level in adrenal tissue
CleanExiHS_FARP1
ExpressionAtlasiQ9Y4F1 baseline and differential
GenevisibleiQ9Y4F1 HS

Family and domain databases

CDDicd14473 FERM_B-lobe, 1 hit
cd00160 RhoGEF, 1 hit
Gene3Di1.20.80.10, 1 hit
1.20.900.10, 1 hit
2.30.29.30, 2 hits
InterProiView protein in InterPro
IPR019749 Band_41_domain
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR000798 Ez/rad/moesin-like
IPR014847 FERM-adjacent
IPR014352 FERM/acyl-CoA-bd_prot_sf
IPR035963 FERM_2
IPR019748 FERM_central
IPR019747 FERM_CS
IPR000299 FERM_domain
IPR018979 FERM_N
IPR018980 FERM_PH-like_C
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR029071 Ubiquitin-like_domsf
PfamiView protein in Pfam
PF08736 FA, 1 hit
PF09380 FERM_C, 1 hit
PF00373 FERM_M, 1 hit
PF09379 FERM_N, 1 hit
PF00169 PH, 2 hits
PF00621 RhoGEF, 1 hit
PRINTSiPR00935 BAND41
PR00661 ERMFAMILY
SMARTiView protein in SMART
SM00295 B41, 1 hit
SM01195 FA, 1 hit
SM01196 FERM_C, 1 hit
SM00233 PH, 2 hits
SM00325 RhoGEF, 1 hit
SUPFAMiSSF47031 SSF47031, 1 hit
SSF48065 SSF48065, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50010 DH_2, 1 hit
PS00660 FERM_1, 1 hit
PS50057 FERM_3, 1 hit
PS50003 PH_DOMAIN, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiFARP1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y4F1
Secondary accession number(s): Q5JVI9, Q6IQ29
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 18, 2006
Last sequence update: November 1, 1999
Last modified: October 10, 2018
This is version 156 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again