Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 192 (05 Jun 2019)
Sequence version 3 (12 Feb 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Ubiquitin carboxyl-terminal hydrolase 15

Gene

USP15

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Hydrolase that removes conjugated ubiquitin from target proteins and regulates various pathways such as the TGF-beta receptor signaling, NF-kappa-B and RNF41/NRDP1-PRKN pathways (PubMed:21947082, PubMed:22344298, PubMed:24852371, PubMed:16005295, PubMed:17318178, PubMed:19826004, PubMed:19576224). Acts as a key regulator of TGF-beta receptor signaling pathway, but the precise mechanism is still unclear: according to a report, acts by promoting deubiquitination of monoubiquitinated R-SMADs (SMAD1, SMAD2 and/or SMAD3), thereby alleviating inhibition of R-SMADs and promoting activation of TGF-beta target genes (PubMed:21947082). According to another reports, regulates the TGF-beta receptor signaling pathway by mediating deubiquitination and stabilization of TGFBR1, leading to an enhanced TGF-beta signal (PubMed:22344298). Able to mediate deubiquitination of monoubiquitinated substrates as well as 'Lys-48'-linked polyubiquitin chains, protecting them against proteasomal degradation. May also regulate gene expression and/or DNA repair through the deubiquitination of histone H2B (PubMed:24526689). Acts as an inhibitor of mitophagy by counteracting the action of parkin (PRKN): hydrolyzes cleavage of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains attached by parkin on target proteins such as MFN2, thereby reducing parkin's ability to drive mitophagy (PubMed:24852371). Acts as an associated component of COP9 signalosome complex (CSN) and regulates different pathways via this association: regulates NF-kappa-B by mediating deubiquitination of NFKBIA and deubiquitinates substrates bound to VCP (PubMed:16005295, PubMed:17318178, PubMed:19826004, PubMed:19576224). Involved in endosome organization by mediating deubiquitination of SQSTM1: ubiquitinated SQSTM1 forms a molecular bridge that restrains cognate vesicles in the perinuclear region and its deubiquitination releases target vesicles for fast transport into the cell periphery (PubMed:27368102).9 Publications
(Microbial infection) Protects APC and human papillomavirus type 16 protein E6 against degradation via the ubiquitin proteasome pathway.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei298NucleophilePROSITE-ProRule annotation5 Publications1
Active sitei891Proton acceptorPROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protease, Thiol protease
Biological processUbl conjugation pathway

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2173788 Downregulation of TGF-beta receptor signaling
R-HSA-5689603 UCH proteinases
R-HSA-5689880 Ub-specific processing proteases

Protein family/group databases

MEROPS protease database

More...
MEROPSi
C19.022

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ubiquitin carboxyl-terminal hydrolase 15 (EC:3.4.19.126 Publications)
Alternative name(s):
Deubiquitinating enzyme 15
Ubiquitin thioesterase 15
Ubiquitin-specific-processing protease 15
Unph-2
Unph4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:USP15
Synonyms:KIAA0529
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:12613 USP15

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604731 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y4E8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Mitochondrion, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi298C → A: Loss of enzyme activity. 5 Publications1
Mutagenesisi812C → A: Loss of activity towards polyubiquitin. 2 Publications1

Organism-specific databases

DisGeNET

More...
DisGeNETi
9958

Open Targets

More...
OpenTargetsi
ENSG00000135655

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37239

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
USP15

Domain mapping of disease mutations (DMDM)

More...
DMDMi
28381406

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources1 Publication
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000806412 – 981Ubiquitin carboxyl-terminal hydrolase 15Add BLAST980

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1 Publication1
Modified residuei226PhosphothreonineCombined sources1
Modified residuei229PhosphoserineCombined sources1
Modified residuei242PhosphoserineCombined sources1
Modified residuei602PhosphothreonineBy similarity1
Modified residuei961PhosphoserineCombined sources1
Modified residuei965PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated. Phosphorylation protects against ubiquitination and subsequent degradation by the proteasome.1 Publication
Ubiquitinated, leading to degradation by the proteasome.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9Y4E8

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9Y4E8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y4E8

PeptideAtlas

More...
PeptideAtlasi
Q9Y4E8

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y4E8

ProteomicsDB human proteome resource

More...
ProteomicsDBi
86183
86184 [Q9Y4E8-2]
86185 [Q9Y4E8-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y4E8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y4E8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in skeletal muscle, kidney, heart, placenta, liver, thymus, lung, and ovary, with little or no expression in other tissues.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000135655 Expressed in 229 organ(s), highest expression level in intestine

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9Y4E8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Y4E8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA006237
HPA006428
HPA071014

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

A homodimer structure has been reported; however it is unclear whether the protein form a homodimer in vivo (PubMed:22001210). Identified in a complex with the COP9 signalosome complex (CSN) (PubMed:16005295). Interacts with SMAD1, SMAD2 and SMAD3; the interaction is direct (PubMed:21947082). Forms a complex with SMURF2 and SMAD7 (PubMed:22344298). Interacts with TGFBR1 (PubMed:22344298). Interacts with SART3; the interaction is direct (PubMed:24526689). May interact with RNF20 and RNF40 (PubMed:24526689). May interact with PRKN (PubMed:24852371). Interacts with INCA1 (PubMed:21750715).7 Publications
(Microbial infection) Interacts with human papillomavirus type 16 protein E6.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115283, 255 interactors

Database of interacting proteins

More...
DIPi
DIP-50239N

Protein interaction database and analysis system

More...
IntActi
Q9Y4E8, 64 interactors

Molecular INTeraction database

More...
MINTi
Q9Y4E8

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000280377

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1981
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Y4E8

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9Y4E8

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini7 – 118DUSPPROSITE-ProRule annotationAdd BLAST112
Domaini289 – 933USPPROSITE-ProRule annotationAdd BLAST645

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni2 – 223Mediates interaction with SART31 PublicationAdd BLAST222

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase C19 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1870 Eukaryota
COG5560 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154932

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000264375

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y4E8

KEGG Orthology (KO)

More...
KOi
K21343

Identification of Orthologs from Complete Genome Data

More...
OMAi
KYSYVTP

Database of Orthologous Groups

More...
OrthoDBi
1283205at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y4E8

TreeFam database of animal gene trees

More...
TreeFami
TF106276

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035927 DUSP-like_sf
IPR038765 Papain-like_cys_pep_sf
IPR006615 Pept_C19_DUSP
IPR001394 Peptidase_C19_UCH
IPR013792 RNA3'P_cycl/enolpyr_Trfase_a/b
IPR028135 Ub_USP-typ
IPR029071 Ubiquitin-like_domsf
IPR029346 USP_C
IPR018200 USP_CS
IPR028889 USP_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06337 DUSP, 1 hit
PF14836 Ubiquitin_3, 1 hit
PF00443 UCH, 1 hit
PF14533 USP7_C2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00695 DUSP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF143791 SSF143791, 1 hit
SSF54001 SSF54001, 1 hit
SSF54236 SSF54236, 1 hit
SSF55205 SSF55205, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51283 DUSP, 1 hit
PS00972 USP_1, 1 hit
PS00973 USP_2, 1 hit
PS50235 USP_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y4E8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEGGAADLD TQRSDIATLL KTSLRKGDTW YLVDSRWFKQ WKKYVGFDSW
60 70 80 90 100
DKYQMGDQNV YPGPIDNSGL LKDGDAQSLK EHLIDELDYI LLPTEGWNKL
110 120 130 140 150
VSWYTLMEGQ EPIARKVVEQ GMFVKHCKVE VYLTELKLCE NGNMNNVVTR
160 170 180 190 200
RFSKADTIDT IEKEIRKIFS IPDEKETRLW NKYMSNTFEP LNKPDSTIQD
210 220 230 240 250
AGLYQGQVLV IEQKNEDGTW PRGPSTPKSP GASNFSTLPK ISPSSLSNNY
260 270 280 290 300
NNMNNRNVKN SNYCLPSYTA YKNYDYSEPG RNNEQPGLCG LSNLGNTCFM
310 320 330 340 350
NSAIQCLSNT PPLTEYFLND KYQEELNFDN PLGMRGEIAK SYAELIKQMW
360 370 380 390 400
SGKFSYVTPR AFKTQVGRFA PQFSGYQQQD CQELLAFLLD GLHEDLNRIR
410 420 430 440 450
KKPYIQLKDA DGRPDKVVAE EAWENHLKRN DSIIVDIFHG LFKSTLVCPE
460 470 480 490 500
CAKISVTFDP FCYLTLPLPM KKERTLEVYL VRMDPLTKPM QYKVVVPKIG
510 520 530 540 550
NILDLCTALS ALSGIPADKM IVTDIYNHRF HRIFAMDENL SSIMERDDIY
560 570 580 590 600
VFEININRTE DTEHVIIPVC LREKFRHSSY THHTGSSLFG QPFLMAVPRN
610 620 630 640 650
NTEDKLYNLL LLRMCRYVKI STETEETEGS LHCCKDQNIN GNGPNGIHEE
660 670 680 690 700
GSPSEMETDE PDDESSQDQE LPSENENSQS EDSVGGDNDS ENGLCTEDTC
710 720 730 740 750
KGQLTGHKKR LFTFQFNNLG NTDINYIKDD TRHIRFDDRQ LRLDERSFLA
760 770 780 790 800
LDWDPDLKKR YFDENAAEDF EKHESVEYKP PKKPFVKLKD CIELFTTKEK
810 820 830 840 850
LGAEDPWYCP NCKEHQQATK KLDLWSLPPV LVVHLKRFSY SRYMRDKLDT
860 870 880 890 900
LVDFPINDLD MSEFLINPNA GPCRYNLIAV SNHYGGMGGG HYTAFAKNKD
910 920 930 940 950
DGKWYYFDDS SVSTASEDQI VSKAAYVLFY QRQDTFSGTG FFPLDRETKG
960 970 980
ASAATGIPLE SDEDSNDNDN DIENENCMHT N
Length:981
Mass (Da):112,419
Last modified:February 12, 2003 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE81FEB9DE57F7089
GO
Isoform 2 (identifier: Q9Y4E8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     228-256: Missing.

Show »
Length:952
Mass (Da):109,297
Checksum:i852ED3768FB5725A
GO
Isoform 3 (identifier: Q9Y4E8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     217-256: DGTWPRGPSTPKSPGASNFSTLPKISPSSLSNNYNNMNNR → QKNEDGTWPRGPSTP

Show »
Length:956
Mass (Da):109,796
Checksum:iF9F83D3886404B11
GO
Isoform 4 (identifier: Q9Y4E8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     229-235: SPGASNF → KPLEQSC
     236-981: Missing.

Show »
Length:235
Mass (Da):27,094
Checksum:iF69B0D2783E2A443
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YI26H0YI26_HUMAN
Ubiquitin carboxyl-terminal hydrola...
USP15
157Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YI31H0YI31_HUMAN
Ubiquitin carboxyl-terminal hydrola...
USP15
240Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VZG8F8VZG8_HUMAN
Ubiquitin carboxyl-terminal hydrola...
USP15
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W0H4F8W0H4_HUMAN
Ubiquitin carboxyl-terminal hydrola...
USP15
175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YH96H0YH96_HUMAN
Ubiquitin carboxyl-terminal hydrola...
USP15
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VVY7F8VVY7_HUMAN
Ubiquitin carboxyl-terminal hydrola...
USP15
106Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YHM4H0YHM4_HUMAN
Ubiquitin carboxyl-terminal hydrola...
USP15
87Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti559T → A in AAG28973 (Ref. 9) Curated1
Sequence conflicti747S → F in AAI25124 (PubMed:15489334).Curated1
Sequence conflicti968N → H in AAG28973 (Ref. 9) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_005260217 – 256DGTWP…NMNNR → QKNEDGTWPRGPSTP in isoform 3. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_005261228 – 256Missing in isoform 2. 3 PublicationsAdd BLAST29
Alternative sequenceiVSP_045165229 – 235SPGASNF → KPLEQSC in isoform 4. 2 Publications7
Alternative sequenceiVSP_045166236 – 981Missing in isoform 4. 2 PublicationsAdd BLAST746

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF106069 mRNA Translation: AAD52099.1
AB011101 mRNA Translation: BAA25455.2
AF153604 mRNA Translation: AAD41086.1
AK023703 mRNA Translation: BAB14648.1
AK292337 mRNA Translation: BAF85026.1
AC048342 Genomic DNA No translation available.
AC079035 Genomic DNA No translation available.
AC117370 Genomic DNA No translation available.
BC020688 mRNA Translation: AAH20688.1
BC063454 mRNA Translation: AAH63454.1
BC125123 mRNA Translation: AAI25124.1
AF013990 mRNA Translation: AAG28973.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS58250.1 [Q9Y4E8-4]
CCDS58251.1 [Q9Y4E8-1]
CCDS8963.1 [Q9Y4E8-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001239007.1, NM_001252078.1 [Q9Y4E8-1]
NP_001239008.1, NM_001252079.1 [Q9Y4E8-4]
NP_006304.1, NM_006313.2 [Q9Y4E8-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000280377; ENSP00000280377; ENSG00000135655 [Q9Y4E8-1]
ENST00000312635; ENSP00000309240; ENSG00000135655 [Q9Y4E8-4]
ENST00000353364; ENSP00000258123; ENSG00000135655 [Q9Y4E8-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9958

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9958

UCSC genome browser

More...
UCSCi
uc001sra.4 human [Q9Y4E8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF106069 mRNA Translation: AAD52099.1
AB011101 mRNA Translation: BAA25455.2
AF153604 mRNA Translation: AAD41086.1
AK023703 mRNA Translation: BAB14648.1
AK292337 mRNA Translation: BAF85026.1
AC048342 Genomic DNA No translation available.
AC079035 Genomic DNA No translation available.
AC117370 Genomic DNA No translation available.
BC020688 mRNA Translation: AAH20688.1
BC063454 mRNA Translation: AAH63454.1
BC125123 mRNA Translation: AAI25124.1
AF013990 mRNA Translation: AAG28973.1
CCDSiCCDS58250.1 [Q9Y4E8-4]
CCDS58251.1 [Q9Y4E8-1]
CCDS8963.1 [Q9Y4E8-2]
RefSeqiNP_001239007.1, NM_001252078.1 [Q9Y4E8-1]
NP_001239008.1, NM_001252079.1 [Q9Y4E8-4]
NP_006304.1, NM_006313.2 [Q9Y4E8-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1W6VNMR-A1-120[»]
3LMNX-ray2.15A/B1-133[»]
3PPAX-ray2.35A6-223[»]
3PV1X-ray2.60A/B1-223[»]
3T9LX-ray1.50A1-222[»]
4A3OX-ray2.20A/B4-223[»]
4A3PX-ray1.40A6-223[»]
5JJWX-ray3.01B1-223[»]
6CPMX-ray2.01C/D275-862[»]
C/D873-934[»]
6CRNX-ray2.50A/B/C/D275-934[»]
6DJ9X-ray3.10A/B/C/D/E/F1-134[»]
6GH9X-ray2.09A/B284-468[»]
A/B786-951[»]
6GHAX-ray1.98A284-468[»]
A786-948[»]
6ML1X-ray1.90A/B275-862[»]
A/B873-934[»]
SMRiQ9Y4E8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115283, 255 interactors
DIPiDIP-50239N
IntActiQ9Y4E8, 64 interactors
MINTiQ9Y4E8
STRINGi9606.ENSP00000280377

Protein family/group databases

MEROPSiC19.022

PTM databases

iPTMnetiQ9Y4E8
PhosphoSitePlusiQ9Y4E8

Polymorphism and mutation databases

BioMutaiUSP15
DMDMi28381406

Proteomic databases

EPDiQ9Y4E8
jPOSTiQ9Y4E8
PaxDbiQ9Y4E8
PeptideAtlasiQ9Y4E8
PRIDEiQ9Y4E8
ProteomicsDBi86183
86184 [Q9Y4E8-2]
86185 [Q9Y4E8-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
9958
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000280377; ENSP00000280377; ENSG00000135655 [Q9Y4E8-1]
ENST00000312635; ENSP00000309240; ENSG00000135655 [Q9Y4E8-4]
ENST00000353364; ENSP00000258123; ENSG00000135655 [Q9Y4E8-2]
GeneIDi9958
KEGGihsa:9958
UCSCiuc001sra.4 human [Q9Y4E8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9958
DisGeNETi9958

GeneCards: human genes, protein and diseases

More...
GeneCardsi
USP15

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0010773
HGNCiHGNC:12613 USP15
HPAiHPA006237
HPA006428
HPA071014
MIMi604731 gene
neXtProtiNX_Q9Y4E8
OpenTargetsiENSG00000135655
PharmGKBiPA37239

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1870 Eukaryota
COG5560 LUCA
GeneTreeiENSGT00940000154932
HOGENOMiHOG000264375
InParanoidiQ9Y4E8
KOiK21343
OMAiKYSYVTP
OrthoDBi1283205at2759
PhylomeDBiQ9Y4E8
TreeFamiTF106276

Enzyme and pathway databases

ReactomeiR-HSA-2173788 Downregulation of TGF-beta receptor signaling
R-HSA-5689603 UCH proteinases
R-HSA-5689880 Ub-specific processing proteases

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
USP15 human
EvolutionaryTraceiQ9Y4E8

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
USP15

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9958

Protein Ontology

More...
PROi
PR:Q9Y4E8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000135655 Expressed in 229 organ(s), highest expression level in intestine
ExpressionAtlasiQ9Y4E8 baseline and differential
GenevisibleiQ9Y4E8 HS

Family and domain databases

InterProiView protein in InterPro
IPR035927 DUSP-like_sf
IPR038765 Papain-like_cys_pep_sf
IPR006615 Pept_C19_DUSP
IPR001394 Peptidase_C19_UCH
IPR013792 RNA3'P_cycl/enolpyr_Trfase_a/b
IPR028135 Ub_USP-typ
IPR029071 Ubiquitin-like_domsf
IPR029346 USP_C
IPR018200 USP_CS
IPR028889 USP_dom
PfamiView protein in Pfam
PF06337 DUSP, 1 hit
PF14836 Ubiquitin_3, 1 hit
PF00443 UCH, 1 hit
PF14533 USP7_C2, 1 hit
SMARTiView protein in SMART
SM00695 DUSP, 1 hit
SUPFAMiSSF143791 SSF143791, 1 hit
SSF54001 SSF54001, 1 hit
SSF54236 SSF54236, 1 hit
SSF55205 SSF55205, 1 hit
PROSITEiView protein in PROSITE
PS51283 DUSP, 1 hit
PS00972 USP_1, 1 hit
PS00973 USP_2, 1 hit
PS50235 USP_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUBP15_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y4E8
Secondary accession number(s): Q08AL5
, Q9H8G9, Q9HCA6, Q9UNP0, Q9Y5B5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: February 12, 2003
Last modified: June 5, 2019
This is version 192 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  4. Peptidase families
    Classification of peptidase families and list of entries
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again