Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

WASH complex subunit 2C

Gene

WASHC2C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts at least in part as component of the WASH core complex whose assembly at the surface of endosomes inhibits WASH nucleation-promoting factor (NPF) activity in recruiting and activating the Arp2/3 complex to induce actin polymerization and is involved in the fission of tubules that serve as transport intermediates during endosome sorting. Mediates the recruitment of the WASH core complex to endosome membranes via binding to phospholipids and VPS35 of the retromer CSC. Mediates the recruitment of the F-actin-capping protein dimer to the WASH core complex probably promoting localized F-actin polymerization needed for vesicle scission (PubMed:19922874, PubMed:20498093, PubMed:22513087, PubMed:23331060). Via its C-terminus binds various phospholipids, most strongly phosphatidylinositol 4-phosphate (PtdIns-4P), phosphatidylinositol 5-phosphate (PtdIns-5P) and phosphatidylinositol 3,5-bisphosphate (PtdIns-(3,5)P2). Involved in the endosome-to-plasma membrane trafficking and recycling of SNX27-retromer-dependent cargo proteins, such as GLUT1 (PubMed:25278552). Required for the association of DNAJC13, ENTR1, ANKRD50 with retromer CSC subunit VPS35 (PubMed:24980502). Required for the endosomal recruitment of CCC complex subunits COMMD1, CCDC93 AND C16orf62 (PubMed:25355947). Plays a role in fluid-phase endocytosis, a process exploited by vaccinia intracellular mature virus (IMV) to enter cells. As a result, may facilitate the penetration of IMV into cells (PubMed:18550675).8 Publications

Miscellaneous

In human, WASHC2 has undergone evolutionary duplication, with 4 highly homologous family members existing, including WASHC2A, WASHC2C, and an N-terminally truncated WASHC2D form.

Caution

A WASHC2C construct with WASHC2A-specific sequence insertions of 2 aa and 21 aa resulting in a construct length of 1341 aa similar to WASHC2A length has been used for a number of experiments; a part of this construct covering the WASHC2A-specific 21 aa insert has been used to produce an anti-WASHC2 antibody (PubMed:19922874, PubMed:22513087, PubMed:20498093).
The function of the WASH complex is debated. One study using partially purified samples reported a nucleation-promoting factor (NPF) activity (PubMed:19922875). In another study, the reconstituted and highly purified recombinant WASH core complex did not show activity toward Arp2/3 complex suggesting a rather inhibitory role towards WASH NPF activity (PubMed:20498093).

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processProtein transport, Transport
LigandLipid-binding

Names & Taxonomyi

Protein namesi
Recommended name:
WASH complex subunit 2CImported
Alternative name(s):
Vaccinia virus penetration factor
Short name:
VPEF
Gene namesi
Name:WASHC2CImported
Synonyms:FAM21C, KIAA0592
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000172661.17
HGNCiHGNC:23414 WASHC2C
MIMi613631 gene
neXtProtiNX_Q9Y4E1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Endosome, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi1010R → A: Disrupts interaction with F-actin-capping protein subunit alpha (CAPZA1 or CAPZA2 or CAPZA3). 1 Publication1
Mutagenesisi1278F → A: Impairs interaction with VPS35. 1 Publication1
Mutagenesisi1310F → A: Impairs interaction with VPS35. 1 Publication1
Mutagenesisi1312D → A: Disrupts interaction with VPS35. 1 Publication1

Organism-specific databases

OpenTargetsiENSG00000172661

Polymorphism and mutation databases

BioMutaiFAM21C
DMDMi284018172

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001867141 – 1320WASH complex subunit 2CAdd BLAST1320

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei539PhosphoserineCombined sources1
Modified residuei550PhosphoserineCombined sources1
Modified residuei909PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9Y4E1
PaxDbiQ9Y4E1
PeptideAtlasiQ9Y4E1
PRIDEiQ9Y4E1
ProteomicsDBi86174
86175 [Q9Y4E1-2]
86176 [Q9Y4E1-3]
86177 [Q9Y4E1-4]

PTM databases

iPTMnetiQ9Y4E1
PhosphoSitePlusiQ9Y4E1

Expressioni

Gene expression databases

BgeeiENSG00000172661 Expressed in 95 organ(s), highest expression level in frontal cortex
CleanExiHS_FAM21C
ExpressionAtlasiQ9Y4E1 baseline and differential
GenevisibleiQ9Y4E1 HS

Organism-specific databases

HPAiHPA047844
HPA060975
HPA061022

Interactioni

Subunit structurei

Component of the WASH core complex also described as WASH regulatory complex (SHRC) composed of WASH (WASHC1, WASH2P or WASH3P), WASHC2 (WASHC2A or WASHC2C), WASHC3, WASHC4 and WASHC5; in the complex interacts (via N-terminus) directly with WASHC1. The WASH core complex associates via WASHC2 with the F-actin-capping protein dimer (formed by CAPZA1, CAPZA2 or CAPZA3 and CAPZB) in a transient or substoichiometric manner which was initially described as WASH complex (PubMed:19922875, PubMed:20498093). Interacts with VPS35; mediates the association with the retromer CSC complex. Interacts with FKBP15. Interacts with CCDC93, CCDC22, C16orf62; indicative for an association of the WASH core complex with the CCC complex. May directly interact with TBC1D23 (Probable).1 Publication8 Publications

Protein-protein interaction databases

BioGridi128984, 18 interactors
ComplexPortaliCPX-1163 WASH complex, variant WASHC1/WASHC2C
CPX-1168 WASH complex, variant WASH2P/WASHC2C
CPX-1169 WASH complex, variant WASH3P/WASHC2C
CPX-1170 WASH complex, variant WASH4P/WASHC2C
CPX-1171 WASH complex, variant WASH6P/WASHC2C
CORUMiQ9Y4E1
IntActiQ9Y4E1, 10 interactors
STRINGi9606.ENSP00000363482

Structurei

3D structure databases

ProteinModelPortaliQ9Y4E1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 220Sufficient for interaction with WASHC3, WASHC4 and WASHC5; required for interaction with WASHC12 PublicationsAdd BLAST220
Regioni356 – 600Sufficient for interaction with CCDC931 PublicationAdd BLAST245
Regioni357 – 1318Interaction with VPS351 PublicationAdd BLAST962
Regioni937 – 1318Interaction with phospholipids1 PublicationAdd BLAST382
Regioni1008 – 1026Required for interaction with F-actin-capping protein subunit alpha (CAPZA1 or CAPZA2 or CAPZA3)1 PublicationAdd BLAST19

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi367 – 378LFa 1CuratedAdd BLAST12
Motifi411 – 419LFa 2Curated9
Motifi450 – 463LFa 3CuratedAdd BLAST14
Motifi482 – 491LFa 4Curated10
Motifi537 – 548LFa 5CuratedAdd BLAST12
Motifi572 – 583LFa 6CuratedAdd BLAST12
Motifi617 – 627LFa 7CuratedAdd BLAST11
Motifi664 – 674LFa 8CuratedAdd BLAST11
Motifi690 – 702LFa 9CuratedAdd BLAST13
Motifi726 – 738LFa 10CuratedAdd BLAST13
Motifi803 – 817LFa 11CuratedAdd BLAST15
Motifi839 – 847LFa 12Curated9
Motifi856 – 862LFa 13Curated7
Motifi878 – 888LFa 14CuratedAdd BLAST11
Motifi1108 – 1115LFa 15Curated8
Motifi1150 – 1164LFa 16CuratedAdd BLAST15
Motifi1180 – 1188LFa 17Curated9
Motifi1213 – 1219LFa 18Curated7
Motifi1241 – 1249LFa 19Curated9
Motifi1269 – 1278LFa 20Curated10
Motifi1309 – 1317LFa 21Curated9

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi102 – 277Glu-richAdd BLAST176
Compositional biasi452 – 461Poly-Asp10
Compositional biasi1074 – 1080Poly-Ala7

Domaini

The LFa (leucine-phenylalanine-acidic) motif bind directly to VPS35 of retromer CSC; adjacent motifs can act cooperatively to bind multiple CSCs, although there is significant variability in the affinities of different motifs for retromer.1 Publication

Sequence similaritiesi

Belongs to the FAM21 family.Curated

Phylogenomic databases

eggNOGiENOG410IEJH Eukaryota
ENOG4110AMY LUCA
GeneTreeiENSGT00510000047694
HOGENOMiHOG000112469
HOVERGENiHBG055529
InParanoidiQ9Y4E1
KOiK18462
PhylomeDBiQ9Y4E1
TreeFamiTF329309

Family and domain databases

InterProiView protein in InterPro
IPR027308 FAM21
IPR029341 FAM21/CAPZIP
PANTHERiPTHR21669:SF24 PTHR21669:SF24, 1 hit
PfamiView protein in Pfam
PF15255 CAP-ZIP_m, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y4E1-4) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMNRTTPDQE LVPASEPVWE RPWSVEEIRR SSQSWSLAAD AGLLQFLQEF
60 70 80 90 100
SQQTISRTHE IKKQVDGLIR ETKATDCRLH NVFNDFLMLS NTQFIENRVY
110 120 130 140 150
DEEVEEPVLK AEAEKTEQEK TREQKEVDLI PKVQEAVNYG LQVLDSAFEQ
160 170 180 190 200
LDIKAGNSDS EEDDANGRVE LILEPKDLYI DRPLPYLIGS KLFMEQEDVG
210 220 230 240 250
LGELSSEEGS VGSDRGSIVD TEEEKEEEES DEDFAHHSDN EQNQHTTQMS
260 270 280 290 300
DEEEDDDGCD LFADSEKEEE DIEDIEENTR PKRSRPTSFA DELAARIKGD
310 320 330 340 350
AMGRVDEEPT TLPSGEAKPR KTLKEKKERR TPSDDEEDNL FAPPKLTDED
360 370 380 390 400
FSPFGSGGGL FSGGKGLFDD EDEESDLFTE ASQDRQAGAS VKEESSSSKP
410 420 430 440 450
GKKIPAGAVS VFLGDTDVFG AASVPSLKEP QKPEQPTPRK SPYGPPPTGL
460 470 480 490 500
FDDDDGDDDD DFFSAPHSKP SKTRKVQSTA DIFGDEEGDL FKEKAVASPE
510 520 530 540 550
ATVSQTDENK ARAEKKVTLS YSKNLKPSSE TKTQKGLFSD EEDSEDLFSS
560 570 580 590 600
QSASNLKGAS LLPGKLPTSV SLFDDEDEED NLFGGTAAKK QTLSLQAQRE
610 620 630 640 650
EKAKASELSK KKASALLFSS DEEDQWNIPA SQTHLASDSR SKGEPRDSGT
660 670 680 690 700
LQSQEAKAVK KTSLFEEDKE DDLFAIAKDS QKKTQRVSLL FEDDVDSGGS
710 720 730 740 750
LFGSPPTSVP PATKKKETVS EAPPLLFSDE EEKEAQLGVK SVDKKVESAK
760 770 780 790 800
ESLKFGRTDV AESEKEGLLT RSAQETVKHS DLFSSSSPWD KGTKPRTKTV
810 820 830 840 850
LSLFDEEEDK MEDQNIIQAP QKEVGKGCDP DAHPKSTGVF QDEELLFSHK
860 870 880 890 900
LQKDNDPDVD LFAGTKKTKL LEPSVGSLFG DDEDDDLFSS AKSQPLVQEK
910 920 930 940 950
KRVVKKDHSV NSFKNQKHPE SIQGSKEKGI WKPETPQANL AINPAALLPT
960 970 980 990 1000
AASQISEVKP VLPELAFPSS EHRRSHGLES VPVLPGSGEA GVSFDLPAQA
1010 1020 1030 1040 1050
DTLHSANKSR VKMRGKRRPQ TRAARRLAAQ ESSEAEDMSV PRGPIAQWAD
1060 1070 1080 1090 1100
GAISPNGHRP QLRAASGEDS TEEALAAAAA PWEGGPVPGV DTSPFAKSLG
1110 1120 1130 1140 1150
HSRGEADLFD SGDIFSTGTG SQSVERTKPK AKIAENPANP PVGGKAKSPM
1160 1170 1180 1190 1200
FPALGEASSD DDLFQSAKPK PAKKTNPFPL LEDEDDLFTD QKVKKNETKS
1210 1220 1230 1240 1250
SSQQDVILTT QDIFEDDIFA TEAIKPSQKT REKEKTLESN LFDDNIDIFA
1260 1270 1280 1290 1300
DLTVKPKEKS KKKVEAKSIF DDDMDDIFST GIQAKTTKPK SRSAQAAPEP
1310 1320
RFEHKVSNIF DDPLNAFGGQ
Length:1,320
Mass (Da):144,911
Last modified:September 12, 2018 - v4
Checksum:i156651EE158BE32F
GO
Isoform 4 (identifier: Q9Y4E1-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     624-625: Missing.

Show »
Length:1,318
Mass (Da):144,668
Checksum:iC3D811B7126425CB
GO
Isoform 2 (identifier: Q9Y4E1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     43-50: Missing.
     624-625: Missing.

Note: Gene prediction confirmed by EST data.
Show »
Length:1,310
Mass (Da):143,649
Checksum:iEC75C67E8A9AD5C8
GO
Isoform 3 (identifier: Q9Y4E1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     43-97: Missing.
     624-625: Missing.

Note: Gene prediction confirmed by EST data.
Show »
Length:1,263
Mass (Da):138,146
Checksum:iEC7677F45D0EA10B
GO
Isoform 5 (identifier: Q9Y4E1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     311-335: TLPSGEAKPRKTLKEKKERRTPSDD → N
     715-765: Missing.

Show »
Length:1,245
Mass (Da):136,541
Checksum:iDD8A6029AD1B2CA5
GO
Isoform 6 (identifier: Q9Y4E1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     895-937: PLVQEKKRVVKKDHSVNSFKNQKHPESIQGSKEKGIWKPETPQ → PL

Show »
Length:1,279
Mass (Da):140,144
Checksum:i1C1ABF0932DF6BC0
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MR88A0A0A0MR88_HUMAN
WASH complex subunit 2C
WASHC2C
1,341Annotation score:
A0A096LPC5A0A096LPC5_HUMAN
WASH complex subunit 2C
WASHC2C
1,341Annotation score:
J3KP36J3KP36_HUMAN
WASH complex subunit 2C
WASHC2C
1,262Annotation score:
A0A0A0MT65A0A0A0MT65_HUMAN
WASH complex subunit 2C
WASHC2C
279Annotation score:

Sequence cautioni

The sequence AAH06456 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAA25518 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti244Q → R in AAI50612 (PubMed:15489334).Curated1
Sequence conflicti302M → V in AAI50612 (PubMed:15489334).Curated1
Sequence conflicti342A → T in AAI50612 (PubMed:15489334).Curated1
Sequence conflicti382S → P in AAI50612 (PubMed:15489334).Curated1
Sequence conflicti427L → M in AAI50612 (PubMed:15489334).Curated1
Sequence conflicti474R → G in AAI50612 (PubMed:15489334).Curated1
Sequence conflicti521Y → S in BAA25518 (PubMed:9628581).Curated1
Sequence conflicti521Y → S in BAG64168 (PubMed:14702039).Curated1
Sequence conflicti1040V → I in BAA25518 (PubMed:9628581).Curated1
Sequence conflicti1280T → S in BAA25518 (PubMed:9628581).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05978643 – 97Missing in isoform 3. Add BLAST55
Alternative sequenceiVSP_05978743 – 50Missing in isoform 2. 8
Alternative sequenceiVSP_059788311 – 335TLPSG…TPSDD → N in isoform 5. Add BLAST25
Alternative sequenceiVSP_059789624 – 625Missing in isoform 4, isoform 2 and isoform 3. 2
Alternative sequenceiVSP_059790715 – 765Missing in isoform 5. Add BLAST51
Alternative sequenceiVSP_059791895 – 937PLVQE…PETPQ → PL in isoform 6. Add BLAST43

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB011164 mRNA Translation: BAA25518.1 Different initiation.
AK303048 mRNA Translation: BAG64168.1
AC012044 Genomic DNA No translation available.
AL645998 Genomic DNA No translation available.
AL731535 Genomic DNA No translation available.
BC006456 mRNA Translation: AAH06456.1 Different initiation.
BC150611 mRNA Translation: AAI50612.1
AL050279 mRNA Translation: CAB43380.2
CCDSiCCDS44374.2 [Q9Y4E1-4]
CCDS53528.1 [Q9Y4E1-6]
CCDS53529.1 [Q9Y4E1-5]
PIRiT00347
T08735
RefSeqiNP_001162577.1, NM_001169106.1 [Q9Y4E1-6]
NP_001162578.1, NM_001169107.1 [Q9Y4E1-5]
NP_056077.2, NM_015262.2 [Q9Y4E1-4]
UniGeneiHs.365286
Hs.449662

Genome annotation databases

EnsembliENST00000374362; ENSP00000363482; ENSG00000172661 [Q9Y4E1-4]
ENST00000537517; ENSP00000442128; ENSG00000172661 [Q9Y4E1-5]
ENST00000540872; ENSP00000439811; ENSG00000172661 [Q9Y4E1-6]
GeneIDi253725
KEGGihsa:253725
UCSCiuc001jcu.4 human [Q9Y4E1-4]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB011164 mRNA Translation: BAA25518.1 Different initiation.
AK303048 mRNA Translation: BAG64168.1
AC012044 Genomic DNA No translation available.
AL645998 Genomic DNA No translation available.
AL731535 Genomic DNA No translation available.
BC006456 mRNA Translation: AAH06456.1 Different initiation.
BC150611 mRNA Translation: AAI50612.1
AL050279 mRNA Translation: CAB43380.2
CCDSiCCDS44374.2 [Q9Y4E1-4]
CCDS53528.1 [Q9Y4E1-6]
CCDS53529.1 [Q9Y4E1-5]
PIRiT00347
T08735
RefSeqiNP_001162577.1, NM_001169106.1 [Q9Y4E1-6]
NP_001162578.1, NM_001169107.1 [Q9Y4E1-5]
NP_056077.2, NM_015262.2 [Q9Y4E1-4]
UniGeneiHs.365286
Hs.449662

3D structure databases

ProteinModelPortaliQ9Y4E1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128984, 18 interactors
ComplexPortaliCPX-1163 WASH complex, variant WASHC1/WASHC2C
CPX-1168 WASH complex, variant WASH2P/WASHC2C
CPX-1169 WASH complex, variant WASH3P/WASHC2C
CPX-1170 WASH complex, variant WASH4P/WASHC2C
CPX-1171 WASH complex, variant WASH6P/WASHC2C
CORUMiQ9Y4E1
IntActiQ9Y4E1, 10 interactors
STRINGi9606.ENSP00000363482

PTM databases

iPTMnetiQ9Y4E1
PhosphoSitePlusiQ9Y4E1

Polymorphism and mutation databases

BioMutaiFAM21C
DMDMi284018172

Proteomic databases

EPDiQ9Y4E1
PaxDbiQ9Y4E1
PeptideAtlasiQ9Y4E1
PRIDEiQ9Y4E1
ProteomicsDBi86174
86175 [Q9Y4E1-2]
86176 [Q9Y4E1-3]
86177 [Q9Y4E1-4]

Protocols and materials databases

DNASUi253725
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000374362; ENSP00000363482; ENSG00000172661 [Q9Y4E1-4]
ENST00000537517; ENSP00000442128; ENSG00000172661 [Q9Y4E1-5]
ENST00000540872; ENSP00000439811; ENSG00000172661 [Q9Y4E1-6]
GeneIDi253725
KEGGihsa:253725
UCSCiuc001jcu.4 human [Q9Y4E1-4]

Organism-specific databases

CTDi253725
EuPathDBiHostDB:ENSG00000172661.17
GeneCardsiWASHC2C
H-InvDBiHIX0170304
HGNCiHGNC:23414 WASHC2C
HPAiHPA047844
HPA060975
HPA061022
MIMi613631 gene
neXtProtiNX_Q9Y4E1
OpenTargetsiENSG00000172661
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IEJH Eukaryota
ENOG4110AMY LUCA
GeneTreeiENSGT00510000047694
HOGENOMiHOG000112469
HOVERGENiHBG055529
InParanoidiQ9Y4E1
KOiK18462
PhylomeDBiQ9Y4E1
TreeFamiTF329309

Miscellaneous databases

ChiTaRSiFAM21C human
GeneWikiiFAM21C
GenomeRNAii253725
PROiPR:Q9Y4E1
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000172661 Expressed in 95 organ(s), highest expression level in frontal cortex
CleanExiHS_FAM21C
ExpressionAtlasiQ9Y4E1 baseline and differential
GenevisibleiQ9Y4E1 HS

Family and domain databases

InterProiView protein in InterPro
IPR027308 FAM21
IPR029341 FAM21/CAPZIP
PANTHERiPTHR21669:SF24 PTHR21669:SF24, 1 hit
PfamiView protein in Pfam
PF15255 CAP-ZIP_m, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiWAC2C_HUMAN
AccessioniPrimary (citable) accession number: Q9Y4E1
Secondary accession number(s): B4DZQ6
, B9EK53, F5H0J6, F5H871, Q5SQU4, Q5SQU5, Q7L521, Q9UG79
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2005
Last sequence update: September 12, 2018
Last modified: October 10, 2018
This is version 132 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again