Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 138 (08 May 2019)
Sequence version 4 (12 Sep 2018)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

WASH complex subunit 2C

Gene

WASHC2C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts at least in part as component of the WASH core complex whose assembly at the surface of endosomes inhibits WASH nucleation-promoting factor (NPF) activity in recruiting and activating the Arp2/3 complex to induce actin polymerization and is involved in the fission of tubules that serve as transport intermediates during endosome sorting. Mediates the recruitment of the WASH core complex to endosome membranes via binding to phospholipids and VPS35 of the retromer CSC. Mediates the recruitment of the F-actin-capping protein dimer to the WASH core complex probably promoting localized F-actin polymerization needed for vesicle scission (PubMed:19922874, PubMed:20498093, PubMed:22513087, PubMed:23331060). Via its C-terminus binds various phospholipids, most strongly phosphatidylinositol 4-phosphate (PtdIns-4P), phosphatidylinositol 5-phosphate (PtdIns-5P) and phosphatidylinositol 3,5-bisphosphate (PtdIns-(3,5)P2). Involved in the endosome-to-plasma membrane trafficking and recycling of SNX27-retromer-dependent cargo proteins, such as GLUT1 (PubMed:25278552). Required for the association of DNAJC13, ENTR1, ANKRD50 with retromer CSC subunit VPS35 (PubMed:24980502). Required for the endosomal recruitment of CCC and retriever complexes subunits COMMD1 and CCDC93 as well as the retrievere complex subunit VPS35L (PubMed:25355947, PubMed:28892079).8 Publications
(Microbial infection) Plays a role in fluid-phase endocytosis, a process exploited by vaccinia intracellular mature virus (IMV) to enter cells. As a result, may facilitate the penetration of IMV into cells.1 Publication

Miscellaneous

In human, WASHC2 has undergone evolutionary duplication, with 4 highly homologous family members existing, including WASHC2A, WASHC2C, and an N-terminally truncated WASHC2D form.

Caution

A WASHC2C construct with WASHC2A-specific sequence insertions of 2 aa and 21 aa resulting in a construct length of 1341 aa similar to WASHC2A length has been used for a number of experiments; a part of this construct covering the WASHC2A-specific 21 aa insert has been used to produce an anti-WASHC2 antibody (PubMed:19922874, PubMed:22513087, PubMed:20498093).
The function of the WASH complex is debated. One study using partially purified samples reported a nucleation-promoting factor (NPF) activity (PubMed:19922875). In another study, the reconstituted and highly purified recombinant WASH core complex did not show activity toward Arp2/3 complex suggesting a rather inhibitory role towards WASH NPF activity (PubMed:20498093).

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processProtein transport, Transport
LigandLipid-binding

Protein family/group databases

Transport Classification Database

More...
TCDBi
9.A.3.1.2 the sorting nexin27 (snx27)-retromer assembly apparatus for recycling integral membrane proteins (snx27-retromeraa) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
WASH complex subunit 2CImported
Alternative name(s):
Vaccinia virus penetration factor1 Publication
Short name:
VPEF1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:WASHC2CImported
Synonyms:FAM21C, KIAA0592, VPEF1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:23414 WASHC2C

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
613631 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y4E1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Endosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1010R → A: Disrupts interaction with F-actin-capping protein subunit alpha (CAPZA1 or CAPZA2 or CAPZA3). 1 Publication1
Mutagenesisi1278F → A: Impairs interaction with VPS35. 1 Publication1
Mutagenesisi1310F → A: Impairs interaction with VPS35. 1 Publication1
Mutagenesisi1312D → A: Disrupts interaction with VPS35. 1 Publication1

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000172661

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
WASHC2C

Domain mapping of disease mutations (DMDM)

More...
DMDMi
284018172

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001867141 – 1320WASH complex subunit 2CAdd BLAST1320

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei539PhosphoserineCombined sources1
Modified residuei550PhosphoserineCombined sources1
Modified residuei909PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9Y4E1

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9Y4E1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y4E1

PeptideAtlas

More...
PeptideAtlasi
Q9Y4E1

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y4E1

ProteomicsDB human proteome resource

More...
ProteomicsDBi
86174
86175 [Q9Y4E1-2]
86176 [Q9Y4E1-3]
86177 [Q9Y4E1-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y4E1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y4E1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000172661 Expressed in 95 organ(s), highest expression level in frontal cortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9Y4E1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Y4E1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA047844
HPA060975
HPA061022

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the WASH core complex also described as WASH regulatory complex (SHRC) composed of WASH (WASHC1, WASH2P or WASH3P), WASHC2 (WASHC2A or WASHC2C), WASHC3, WASHC4 and WASHC5; in the complex interacts (via N-terminus) directly with WASHC1. The WASH core complex associates via WASHC2 with the F-actin-capping protein dimer (formed by CAPZA1, CAPZA2 or CAPZA3 and CAPZB) in a transient or substoichiometric manner which was initially described as WASH complex (PubMed:19922875, PubMed:20498093).

Interacts with VPS35; mediates the association with the retromer CSC complex.

Interacts with FKBP15.

Interacts with CCDC93, CCDC22, VPS35L; indicative for an association of the WASH core complex with the CCC and retriever complexes. May directly interact with TBC1D23 (Probable).

1 Publication8 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
128984, 18 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-1163 WASH complex, variant WASHC1/WASHC2C
CPX-1168 WASH complex, variant WASH2P/WASHC2C
CPX-1169 WASH complex, variant WASH3P/WASHC2C
CPX-1170 WASH complex, variant WASH4P/WASHC2C
CPX-1171 WASH complex, variant WASH6P/WASHC2C

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9Y4E1

Protein interaction database and analysis system

More...
IntActi
Q9Y4E1, 11 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000363482

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 220Sufficient for interaction with WASHC3, WASHC4 and WASHC5; required for interaction with WASHC12 PublicationsAdd BLAST220
Regioni356 – 600Sufficient for interaction with CCDC931 PublicationAdd BLAST245
Regioni357 – 1318Interaction with VPS351 PublicationAdd BLAST962
Regioni937 – 1318Interaction with phospholipids1 PublicationAdd BLAST382
Regioni1008 – 1026Required for interaction with F-actin-capping protein subunit alpha (CAPZA1 or CAPZA2 or CAPZA3)1 PublicationAdd BLAST19

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi367 – 378LFa 1CuratedAdd BLAST12
Motifi411 – 419LFa 2Curated9
Motifi450 – 463LFa 3CuratedAdd BLAST14
Motifi482 – 491LFa 4Curated10
Motifi537 – 548LFa 5CuratedAdd BLAST12
Motifi572 – 583LFa 6CuratedAdd BLAST12
Motifi617 – 627LFa 7CuratedAdd BLAST11
Motifi664 – 674LFa 8CuratedAdd BLAST11
Motifi690 – 702LFa 9CuratedAdd BLAST13
Motifi726 – 738LFa 10CuratedAdd BLAST13
Motifi803 – 817LFa 11CuratedAdd BLAST15
Motifi839 – 847LFa 12Curated9
Motifi856 – 862LFa 13Curated7
Motifi878 – 888LFa 14CuratedAdd BLAST11
Motifi1108 – 1115LFa 15Curated8
Motifi1150 – 1164LFa 16CuratedAdd BLAST15
Motifi1180 – 1188LFa 17Curated9
Motifi1213 – 1219LFa 18Curated7
Motifi1241 – 1249LFa 19Curated9
Motifi1269 – 1278LFa 20Curated10
Motifi1309 – 1317LFa 21Curated9

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi102 – 277Glu-richAdd BLAST176
Compositional biasi452 – 461Poly-Asp10
Compositional biasi1074 – 1080Poly-Ala7

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The LFa (leucine-phenylalanine-acidic) motif bind directly to VPS35 of retromer CSC; adjacent motifs can act cooperatively to bind multiple CSCs, although there is significant variability in the affinities of different motifs for retromer.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the FAM21 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IEJH Eukaryota
ENOG4110AMY LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153997

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000112469

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y4E1

KEGG Orthology (KO)

More...
KOi
K18462

Database of Orthologous Groups

More...
OrthoDBi
131637at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y4E1

TreeFam database of animal gene trees

More...
TreeFami
TF329309

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029341 FAM21/CAPZIP

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15255 CAP-ZIP_m, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y4E1-4) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMNRTTPDQE LVPASEPVWE RPWSVEEIRR SSQSWSLAAD AGLLQFLQEF
60 70 80 90 100
SQQTISRTHE IKKQVDGLIR ETKATDCRLH NVFNDFLMLS NTQFIENRVY
110 120 130 140 150
DEEVEEPVLK AEAEKTEQEK TREQKEVDLI PKVQEAVNYG LQVLDSAFEQ
160 170 180 190 200
LDIKAGNSDS EEDDANGRVE LILEPKDLYI DRPLPYLIGS KLFMEQEDVG
210 220 230 240 250
LGELSSEEGS VGSDRGSIVD TEEEKEEEES DEDFAHHSDN EQNQHTTQMS
260 270 280 290 300
DEEEDDDGCD LFADSEKEEE DIEDIEENTR PKRSRPTSFA DELAARIKGD
310 320 330 340 350
AMGRVDEEPT TLPSGEAKPR KTLKEKKERR TPSDDEEDNL FAPPKLTDED
360 370 380 390 400
FSPFGSGGGL FSGGKGLFDD EDEESDLFTE ASQDRQAGAS VKEESSSSKP
410 420 430 440 450
GKKIPAGAVS VFLGDTDVFG AASVPSLKEP QKPEQPTPRK SPYGPPPTGL
460 470 480 490 500
FDDDDGDDDD DFFSAPHSKP SKTRKVQSTA DIFGDEEGDL FKEKAVASPE
510 520 530 540 550
ATVSQTDENK ARAEKKVTLS YSKNLKPSSE TKTQKGLFSD EEDSEDLFSS
560 570 580 590 600
QSASNLKGAS LLPGKLPTSV SLFDDEDEED NLFGGTAAKK QTLSLQAQRE
610 620 630 640 650
EKAKASELSK KKASALLFSS DEEDQWNIPA SQTHLASDSR SKGEPRDSGT
660 670 680 690 700
LQSQEAKAVK KTSLFEEDKE DDLFAIAKDS QKKTQRVSLL FEDDVDSGGS
710 720 730 740 750
LFGSPPTSVP PATKKKETVS EAPPLLFSDE EEKEAQLGVK SVDKKVESAK
760 770 780 790 800
ESLKFGRTDV AESEKEGLLT RSAQETVKHS DLFSSSSPWD KGTKPRTKTV
810 820 830 840 850
LSLFDEEEDK MEDQNIIQAP QKEVGKGCDP DAHPKSTGVF QDEELLFSHK
860 870 880 890 900
LQKDNDPDVD LFAGTKKTKL LEPSVGSLFG DDEDDDLFSS AKSQPLVQEK
910 920 930 940 950
KRVVKKDHSV NSFKNQKHPE SIQGSKEKGI WKPETPQANL AINPAALLPT
960 970 980 990 1000
AASQISEVKP VLPELAFPSS EHRRSHGLES VPVLPGSGEA GVSFDLPAQA
1010 1020 1030 1040 1050
DTLHSANKSR VKMRGKRRPQ TRAARRLAAQ ESSEAEDMSV PRGPIAQWAD
1060 1070 1080 1090 1100
GAISPNGHRP QLRAASGEDS TEEALAAAAA PWEGGPVPGV DTSPFAKSLG
1110 1120 1130 1140 1150
HSRGEADLFD SGDIFSTGTG SQSVERTKPK AKIAENPANP PVGGKAKSPM
1160 1170 1180 1190 1200
FPALGEASSD DDLFQSAKPK PAKKTNPFPL LEDEDDLFTD QKVKKNETKS
1210 1220 1230 1240 1250
SSQQDVILTT QDIFEDDIFA TEAIKPSQKT REKEKTLESN LFDDNIDIFA
1260 1270 1280 1290 1300
DLTVKPKEKS KKKVEAKSIF DDDMDDIFST GIQAKTTKPK SRSAQAAPEP
1310 1320
RFEHKVSNIF DDPLNAFGGQ
Length:1,320
Mass (Da):144,911
Last modified:September 12, 2018 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i156651EE158BE32F
GO
Isoform 4 (identifier: Q9Y4E1-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     624-625: Missing.

Show »
Length:1,318
Mass (Da):144,668
Checksum:iC3D811B7126425CB
GO
Isoform 2 (identifier: Q9Y4E1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     43-50: Missing.
     624-625: Missing.

Note: Gene prediction confirmed by EST data.
Show »
Length:1,310
Mass (Da):143,649
Checksum:iEC75C67E8A9AD5C8
GO
Isoform 3 (identifier: Q9Y4E1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     43-97: Missing.
     624-625: Missing.

Note: Gene prediction confirmed by EST data.
Show »
Length:1,263
Mass (Da):138,146
Checksum:iEC7677F45D0EA10B
GO
Isoform 5 (identifier: Q9Y4E1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     311-335: TLPSGEAKPRKTLKEKKERRTPSDD → N
     715-765: Missing.

Show »
Length:1,245
Mass (Da):136,541
Checksum:iDD8A6029AD1B2CA5
GO
Isoform 6 (identifier: Q9Y4E1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     895-937: PLVQEKKRVVKKDHSVNSFKNQKHPESIQGSKEKGIWKPETPQ → PL

Show »
Length:1,279
Mass (Da):140,144
Checksum:i1C1ABF0932DF6BC0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A096LPC5A0A096LPC5_HUMAN
WASH complex subunit 2C
WASHC2C
1,341Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MR88A0A0A0MR88_HUMAN
WASH complex subunit 2C
WASHC2C
1,341Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KP36J3KP36_HUMAN
WASH complex subunit 2C
WASHC2C
1,262Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MT65A0A0A0MT65_HUMAN
WASH complex subunit 2C
WASHC2C
279Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH06456 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAA25518 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti244Q → R in AAI50612 (PubMed:15489334).Curated1
Sequence conflicti302M → V in AAI50612 (PubMed:15489334).Curated1
Sequence conflicti342A → T in AAI50612 (PubMed:15489334).Curated1
Sequence conflicti382S → P in AAI50612 (PubMed:15489334).Curated1
Sequence conflicti427L → M in AAI50612 (PubMed:15489334).Curated1
Sequence conflicti474R → G in AAI50612 (PubMed:15489334).Curated1
Sequence conflicti521Y → S in BAA25518 (PubMed:9628581).Curated1
Sequence conflicti521Y → S in BAG64168 (PubMed:14702039).Curated1
Sequence conflicti1040V → I in BAA25518 (PubMed:9628581).Curated1
Sequence conflicti1280T → S in BAA25518 (PubMed:9628581).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_05978643 – 97Missing in isoform 3. Add BLAST55
Alternative sequenceiVSP_05978743 – 50Missing in isoform 2. 8
Alternative sequenceiVSP_059788311 – 335TLPSG…TPSDD → N in isoform 5. Add BLAST25
Alternative sequenceiVSP_059789624 – 625Missing in isoform 4, isoform 2 and isoform 3. 2
Alternative sequenceiVSP_059790715 – 765Missing in isoform 5. Add BLAST51
Alternative sequenceiVSP_059791895 – 937PLVQE…PETPQ → PL in isoform 6. Add BLAST43

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB011164 mRNA Translation: BAA25518.1 Different initiation.
AK303048 mRNA Translation: BAG64168.1
AC012044 Genomic DNA No translation available.
AL645998 Genomic DNA No translation available.
AL731535 Genomic DNA No translation available.
BC006456 mRNA Translation: AAH06456.1 Different initiation.
BC150611 mRNA Translation: AAI50612.1
AL050279 mRNA Translation: CAB43380.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44374.2 [Q9Y4E1-4]
CCDS53528.1 [Q9Y4E1-6]
CCDS53529.1 [Q9Y4E1-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
T00347
T08735

NCBI Reference Sequences

More...
RefSeqi
NP_001162577.1, NM_001169106.1 [Q9Y4E1-6]
NP_001162578.1, NM_001169107.1 [Q9Y4E1-5]
NP_056077.2, NM_015262.2 [Q9Y4E1-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000374362; ENSP00000363482; ENSG00000172661 [Q9Y4E1-4]
ENST00000537517; ENSP00000442128; ENSG00000172661 [Q9Y4E1-5]
ENST00000540872; ENSP00000439811; ENSG00000172661 [Q9Y4E1-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
253725

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:253725

UCSC genome browser

More...
UCSCi
uc001jcu.4 human [Q9Y4E1-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB011164 mRNA Translation: BAA25518.1 Different initiation.
AK303048 mRNA Translation: BAG64168.1
AC012044 Genomic DNA No translation available.
AL645998 Genomic DNA No translation available.
AL731535 Genomic DNA No translation available.
BC006456 mRNA Translation: AAH06456.1 Different initiation.
BC150611 mRNA Translation: AAI50612.1
AL050279 mRNA Translation: CAB43380.2
CCDSiCCDS44374.2 [Q9Y4E1-4]
CCDS53528.1 [Q9Y4E1-6]
CCDS53529.1 [Q9Y4E1-5]
PIRiT00347
T08735
RefSeqiNP_001162577.1, NM_001169106.1 [Q9Y4E1-6]
NP_001162578.1, NM_001169107.1 [Q9Y4E1-5]
NP_056077.2, NM_015262.2 [Q9Y4E1-4]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi128984, 18 interactors
ComplexPortaliCPX-1163 WASH complex, variant WASHC1/WASHC2C
CPX-1168 WASH complex, variant WASH2P/WASHC2C
CPX-1169 WASH complex, variant WASH3P/WASHC2C
CPX-1170 WASH complex, variant WASH4P/WASHC2C
CPX-1171 WASH complex, variant WASH6P/WASHC2C
CORUMiQ9Y4E1
IntActiQ9Y4E1, 11 interactors
STRINGi9606.ENSP00000363482

Protein family/group databases

TCDBi9.A.3.1.2 the sorting nexin27 (snx27)-retromer assembly apparatus for recycling integral membrane proteins (snx27-retromeraa) family

PTM databases

iPTMnetiQ9Y4E1
PhosphoSitePlusiQ9Y4E1

Polymorphism and mutation databases

BioMutaiWASHC2C
DMDMi284018172

Proteomic databases

EPDiQ9Y4E1
jPOSTiQ9Y4E1
PaxDbiQ9Y4E1
PeptideAtlasiQ9Y4E1
PRIDEiQ9Y4E1
ProteomicsDBi86174
86175 [Q9Y4E1-2]
86176 [Q9Y4E1-3]
86177 [Q9Y4E1-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
253725
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000374362; ENSP00000363482; ENSG00000172661 [Q9Y4E1-4]
ENST00000537517; ENSP00000442128; ENSG00000172661 [Q9Y4E1-5]
ENST00000540872; ENSP00000439811; ENSG00000172661 [Q9Y4E1-6]
GeneIDi253725
KEGGihsa:253725
UCSCiuc001jcu.4 human [Q9Y4E1-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
253725

GeneCards: human genes, protein and diseases

More...
GeneCardsi
WASHC2C

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0170304
HGNCiHGNC:23414 WASHC2C
HPAiHPA047844
HPA060975
HPA061022
MIMi613631 gene
neXtProtiNX_Q9Y4E1
OpenTargetsiENSG00000172661

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IEJH Eukaryota
ENOG4110AMY LUCA
GeneTreeiENSGT00940000153997
HOGENOMiHOG000112469
InParanoidiQ9Y4E1
KOiK18462
OrthoDBi131637at2759
PhylomeDBiQ9Y4E1
TreeFamiTF329309

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FAM21C human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
FAM21C

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
253725

Protein Ontology

More...
PROi
PR:Q9Y4E1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000172661 Expressed in 95 organ(s), highest expression level in frontal cortex
ExpressionAtlasiQ9Y4E1 baseline and differential
GenevisibleiQ9Y4E1 HS

Family and domain databases

InterProiView protein in InterPro
IPR029341 FAM21/CAPZIP
PfamiView protein in Pfam
PF15255 CAP-ZIP_m, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiWAC2C_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y4E1
Secondary accession number(s): B4DZQ6
, B9EK53, F5H0J6, F5H871, Q5SQU4, Q5SQU5, Q7L521, Q9UG79
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2005
Last sequence update: September 12, 2018
Last modified: May 8, 2019
This is version 138 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again