Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 137 (16 Oct 2019)
Sequence version 5 (13 Jul 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Probable E3 ubiquitin-protein ligase HECTD4

Gene

HECTD4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. EC:2.3.2.26

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei3964Glycyl thioester intermediatePROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway

Enzyme and pathway databases

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Probable E3 ubiquitin-protein ligase HECTD4 (EC:2.3.2.26)
Alternative name(s):
HECT domain-containing protein 4
HECT-type E3 ubiquitin transferase HECTD4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HECTD4
Synonyms:C12orf51, KIAA0614
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26611 HECTD4

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y4D8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei282 – 302HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
283450

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9Y4D8

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
HECTD4

Domain mapping of disease mutations (DMDM)

More...
DMDMi
300669718

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003426811 – 3996Probable E3 ubiquitin-protein ligase HECTD4Add BLAST3996

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2080PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9Y4D8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9Y4D8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y4D8

PeptideAtlas

More...
PeptideAtlasi
Q9Y4D8

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y4D8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
86170 [Q9Y4D8-1]
86171 [Q9Y4D8-2]
86172 [Q9Y4D8-3]
86173 [Q9Y4D8-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y4D8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y4D8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA041062
HPA045473

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
P631042EBI-7195436,EBI-347088

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q9Y4D8, 14 interactors

Molecular INTeraction database

More...
MINTi
Q9Y4D8

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000449784

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini3627 – 3996HECTPROSITE-ProRule annotationAdd BLAST370

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi2867 – 2909Ser-richAdd BLAST43

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1426 Eukaryota
COG5184 LUCA

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y4D8

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y4D8

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00078 HECTc, 1 hit
cd13735 SPRY_HECT_like, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000569 HECT_dom
IPR035983 Hect_E3_ubiquitin_ligase
IPR035781 SPRY_HECTD4

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00632 HECT, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00119 HECTc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56204 SSF56204, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50237 HECT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y4D8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPANHLPIGS TMSTVHLSSD GTYFYWIWSP ASLNEKTPKG HSVFMDIFEL
60 70 80 90 100
VVENGVFVAN PLQERTILMR KEGESAKSIN EMLLSRLSRY RASPSATLAA
110 120 130 140 150
LTGSTISNTL KEDQAANTSC GLPLKMLRKT PIYTCGTYLV MLVPPPGGSG
160 170 180 190 200
SSATRSLFGG TSGLSSLKRA CYDTVNNMLW TCSNDYIDQW CNPGNQAFHY
210 220 230 240 250
VCQRLGVSHI ITEPKEEAIT TNEVINQLLH HVGAMCIHQL NLLATNPNLP
260 270 280 290 300
ITSVLGKQHP IEAHHLSSIC DIMEKAMVNG DTCIIRCILV VFQVVFKFFF
310 320 330 340 350
SPQTERNRDI IRRSGLLLWQ LLMAPKDQIC PEIQKEVCLA ISSGLNILYP
360 370 380 390 400
GETEINNLLK LVLTEGERNS GLSQLRDVIL TNLAEQLQNN RFGSDEDDHY
410 420 430 440 450
RLNDELLHYI LKIVVRESCI LITKCQTVSK DDFQKLLSTV PAASSCLRYL
460 470 480 490 500
MAVQNHLLSN TILIKPDEND DSDSSLQGET LKVQELKVSI LALATQILTG
510 520 530 540 550
CDEVLEMLQQ VTTALINSDI ADREQRLKGL EQVTKATMLG HLLPVLLTSL
560 570 580 590 600
MHPNLQTLIM ADALMPQLVQ LVLYTSQTAL LLKTQCPVFA EVGCSPCGAP
610 620 630 640 650
DQKCRLFPDE RMLEEKEEPG FLTGLKIPAP WAAGKTVETV HPVRDNYKFK
660 670 680 690 700
ETVHIPGARC LYLRFDSRCS SQYDYDKLVI YAGPNTNSRK VAEYGGNTLG
710 720 730 740 750
YGSRSVLGTG WPKDLVKCIS PPSLNFKVEG DTVTFSFEMR SGREHNTPDK
760 770 780 790 800
AMWGFACTVR AQESSEDVSG GLPFLVDLAL GLSVLACSML RILYNGPEIT
810 820 830 840 850
KEEEACQELL RSKLLQRCQW QVEANGVISP ALTPSPSPLP LTIEEDREFT
860 870 880 890 900
YPSDVLVPPV GNYFDLPRIR LPPGIMIKLR EISGRARPQF RPSIKEVIQP
910 920 930 940 950
DVMEEMVVSC VIKHLNLVDA LQSLINFQYQ EEHAEEYDLL CKIMGETFKK
960 970 980 990 1000
LNAMERQLQS VAELEQKWQS EVDDAMQGKL ENNMPFFYDY HFNENKMKEL
1010 1020 1030 1040 1050
ELLCSMKEVS FDGNDLENMV LSLREKFLQE VNSLIQKPSH PLAKTKTLVK
1060 1070 1080 1090 1100
SLMNRAELLL HVTIAAQSGL TRSISGTPAE TPACKSASET KVISHAVRQP
1110 1120 1130 1140 1150
VFLRSMSAPS DLEMIGNEDL EFTRANQRRR HVTSHRSSSF TLLQSLAIED
1160 1170 1180 1190 1200
SRDKPTYSVL LGQLFAFIGT NPDQAVSSSS FLLAAQTRWR RGNTRKQALV
1210 1220 1230 1240 1250
HMRELLTAAV RVGGVTHLVG PVTMVLQGGP RIEELTCGGM VEQVQEAFGE
1260 1270 1280 1290 1300
TMTSVVSLCA RYPIACANSI GLLCTIPYTR SEEKCLVRSG LVQLMDRLCS
1310 1320 1330 1340 1350
LSNQTESSSS EKQTKKQKVA TMAWAAFQVL ANRCVEWEKE EGGSTEAVHS
1360 1370 1380 1390 1400
GLARQVSSLL TNHLARATEC CGNQAAGNDA LQDVLSLLND LSRSHIGKAI
1410 1420 1430 1440 1450
LSQPACVSKL LSLLLDQRPS PKLVLIILQL CRAALPLMSV EDCGNVELPP
1460 1470 1480 1490 1500
WSYSVPSLNS EQEDPSDPAS KIASLLLAKL ADYVVPGCQT VLSPTASEPD
1510 1520 1530 1540 1550
TTLTKTSPKN SLKGDKDPGE ESEAVDGKLS IFIHKREDQS SHEVLQPLLS
1560 1570 1580 1590 1600
SSEGRPFRLG TGANMEKVVK MDRDMTKGGC CEVITEEAAA ALRKATKWAQ
1610 1620 1630 1640 1650
SGLIVSIGPP VESINPETVS GLSTGDKKKT AQTSICRERN SELARTDPVR
1660 1670 1680 1690 1700
PFISGHVANS MAAEVIALLH SLLMAPESNA AQIWTTTAEK VLSRALMYIP
1710 1720 1730 1740 1750
QLGKYAESIL ENGSSSGRKL AKLQRIARQA VAALCALGGF KETIKIGSEV
1760 1770 1780 1790 1800
QVLGRGISGS IGVVASINEQ EGIATVRFPP IDCRKTSQAS DTLTIPLSRL
1810 1820 1830 1840 1850
CVPRSEALPL HKLSITEKVV QAVQSMLLPQ EGSLSIHTSL PATGDGSAPV
1860 1870 1880 1890 1900
MAVVRLLAEI RTRACLVMAQ LLEDSLFCEE FIQQCPAAVE VLNLVAQECS
1910 1920 1930 1940 1950
AGERLAVVEV QCERLRMLYR DCARPPPPPL QADRRQPKEI TWSPSRVFPP
1960 1970 1980 1990 2000
VRACMFSSHL TSVTFLADPS AGGGLPRGTF IYATSPLPVQ APSFYWEIEI
2010 2020 2030 2040 2050
VSYGDTDDDT GPIVSFGFTT EAEKRDGAWT NPVGTCLFHN NGRAVHYNGS
2060 2070 2080 2090 2100
SLLQWKSVRL DVTLSPGDVA GIGWERTEGT PPPPGQPAKG RVYFTYCGQR
2110 2120 2130 2140 2150
LSPYLEDVSG GMWPVVHIQK KNTKTRANFG SRPFAYAEGQ AHRNAADLCT
2160 2170 2180 2190 2200
DLAEEISANF EALPFAMASD SDNDAGTSIA SDPGTHGPPC RIAAVATAQQ
2210 2220 2230 2240 2250
QYDSDTSCHY KVELSYENFI TSGPDPHPPP IADDESDDDD DDDIPQEDHY
2260 2270 2280 2290 2300
ALLVKAWETK VFPTIRRRFR NEAERKSGLD QIKGALQLGM VDIARQTVEF
2310 2320 2330 2340 2350
LYEENGGIPR DLYLPTIEDI KDEANKFTID KVRKGLTVVT RSPDSNNVAS
2360 2370 2380 2390 2400
SAVGTALPKF AIRGMLKTFG LHGVVLDVDS VNELVQVETY LRSEGVLVRY
2410 2420 2430 2440 2450
WYPIDMLERP PAGYRRTATN GLVTLDNTNL QIHRELLRCE AALARLYCRM
2460 2470 2480 2490 2500
ALLNIFAPKL PHLFTRLFHI PAIRDITLEH LQLLSNQLLA PPLPDGTISS
2510 2520 2530 2540 2550
SSILLAQSLQ HCIHSQNCSA TDLFYQGNSQ TVREWLNVAI TRTLHQGEES
2560 2570 2580 2590 2600
LLELTKQICS FLQTAPEQFP SEEFPISESK VNMDVNFPGA AFVVVSCKES
2610 2620 2630 2640 2650
QSGFRKDSSL YKAPWARVLV YGLGHKVKRN GQLNLIEAAC YPRDASPANT
2660 2670 2680 2690 2700
GLAPPPTADQ YPSVVLSTDR VHIKLGVSPP PGAVLVLHSL PLEFPLAMAF
2710 2720 2730 2740 2750
AEQLLSWKSE DSEGKSEDEP DTIPTSVLLQ VVELLGNFLW TTDMAACVKE
2760 2770 2780 2790 2800
LVFHLLAELL RTVHTLEQRR HPAGLSSSIA LQLNPCLAML MALQSELHKL
2810 2820 2830 2840 2850
YDEETQNWVS GGACGGSGGA AAGDQGRFST YFHALMEGCL AVAEVTLPTN
2860 2870 2880 2890 2900
MSVTASGVTS ATAPNLSDSS SSSSSSPGQT PQSPSLLSKR KKVKMKREKA
2910 2920 2930 2940 2950
SSSGKRQSSR TVDSDPTVLS IGGSKPEDML WFHRALTLLI ILRHLTRKDP
2960 2970 2980 2990 3000
QGLGVTSDAI ADACQALVGP TAHSRLLVIS GIPTHLDEGV VRGAIRKACN
3010 3020 3030 3040 3050
AHGGVFKDEI YIPLQEEDTK KPKDKAEGGD GKVEPEKTLA FPGTDSMEVS
3060 3070 3080 3090 3100
TSSSLTPAMS ISASASTSQA SICSSQGISQ TVSDLSVDPL PAGLELPIPP
3110 3120 3130 3140 3150
GLLEPHAVSS QESLDISLCS TGSLGSLGSL GEPLDNAETA SVSDMGSMYT
3160 3170 3180 3190 3200
VTSLDNQPLA ARPIKGFAVV EIRSRAKIEK IRASLFNNND LIGLSSLDGE
3210 3220 3230 3240 3250
DELMEMSTEE ILTVSVVNQS LFDTQGSPGL EDYFNDKSIK GEKLVPGARE
3260 3270 3280 3290 3300
VLTEIFKSCA HSEQTLSLTP AKPIRVSDIY LSKEQINSQT PGNLLHLFFT
3310 3320 3330 3340 3350
NVRPPKKVLE DQLTQILRKY GVPKPKFDKS KYSKAGKEQH PVKVVSTKRP
3360 3370 3380 3390 3400
ITKPPAKDKA VLNSVSRTAL SEKKPTVKPK SPEKSKPDEK DPEKSPTKKQ
3410 3420 3430 3440 3450
EVPEEKYLTL EGFHKFVIDR ARQDIRSVWR AILSCGYDLH FERCACIDVR
3460 3470 3480 3490 3500
HAQKASRKWT LEMDVALVQY INQLCRHLAI TPARLHPHEV YLDPADAADP
3510 3520 3530 3540 3550
RVACLLNVPI ESLRLRFALL QSLNTTLETF FLPLVELRQT PMYTHSIAAL
3560 3570 3580 3590 3600
LKEAKGLIFY DTKVTVMNRV LNATVQRTAD HAAPEITLDP LEIVGGEIRA
3610 3620 3630 3640 3650
SENSYFCQAA RQLASVPSSQ LCVKLASGGD PTYAFNIRFT GEEVHGTSGS
3660 3670 3680 3690 3700
FRHFLWQVCK ELQSSSLSLL LLCPSSAVNK NKGKYILTPS PITYGEEQLL
3710 3720 3730 3740 3750
HFLGQLLGIA IRADVPLPLD LLPSFWKTLV GEPLDPEQDL QEADILTYNY
3760 3770 3780 3790 3800
VKKFESINDE TELEALCAEI ASQHLATESP DSPNKPCCRF TYLTMTGEEV
3810 3820 3830 3840 3850
ELCSRGRHIL VAWENKDIYA AAIRSLRLRE LQNVECVTAV RAGLGSIIPL
3860 3870 3880 3890 3900
QLLTMLSPLE MELRTCGLPY INLEFLKAHT MYQVGLMETD QHIEFFWGAL
3910 3920 3930 3940 3950
EMFTQEELCK FIKFACNQER IPFTCPCKDG GPDTAHVPPY PMKIAPPDGT
3960 3970 3980 3990
AGSPDSRYIR VETCMFMIKL PQYSSLEIML EKLRCAIHYR EDPLSG
Length:3,996
Mass (Da):439,344
Last modified:July 13, 2010 - v5
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5F091CA1EDD207D4
GO
Isoform 2 (identifier: Q9Y4D8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2382-2386: NELVQ → SEQPF
     2387-3996: Missing.

Note: No experimental confirmation available.
Show »
Length:2,386
Mass (Da):262,203
Checksum:i2F062A3F80AC9BF5
GO
Isoform 3 (identifier: Q9Y4D8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     717-726: Missing.
     896-899: EVIQ → YVAV
     900-3996: Missing.

Note: No experimental confirmation available.
Show »
Length:889
Mass (Da):98,752
Checksum:iE1CAC6DAF98832A6
GO
Isoform 4 (identifier: Q9Y4D8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     483-484: Missing.
     717-726: Missing.

Note: No experimental confirmation available.
Show »
Length:3,984
Mass (Da):438,030
Checksum:iECFB26B97AE232D9
GO
Isoform 5 (identifier: Q9Y4D8-5) [UniParc]FASTAAdd to basket
Also known as: POTAGE

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGSSAAAAAA...TLQVCQVVPM
     169-169: R → ILASSLVYNISDGQFTSRADLIDAAGSSLGRGALVPGLG
     717-726: Missing.
     896-899: EVIQ → YVAV
     900-3996: Missing.

Show »
Length:1,321
Mass (Da):145,076
Checksum:i794DC0E73FB9A093
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8VWT9F8VWT9_HUMAN
Probable E3 ubiquitin-protein ligas...
HECTD4
4,284Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KPF0J3KPF0_HUMAN
Probable E3 ubiquitin-protein ligas...
HECTD4
4,416Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GYT9V9GYT9_HUMAN
Probable E3 ubiquitin-protein ligas...
HECTD4
262Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A494C150A0A494C150_HUMAN
Probable E3 ubiquitin-protein ligas...
HECTD4
1,828Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VU57F8VU57_HUMAN
Probable E3 ubiquitin-protein ligas...
HECTD4
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF36539 differs from that shown. Contaminating sequence. Sequence of unknown origin in the N-terminal part.Curated
The sequence AAH65706 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH65706 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAI01483 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAA31589 differs from that shown. Contaminating sequence. Sequence of unknown origin in the N-terminal part.Curated
The sequence BAC03671 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti170A → G in AAH65706 (PubMed:15489334).Curated1
Sequence conflicti681Y → C in BAC03671 (PubMed:14702039).Curated1
Sequence conflicti801K → E in AAH65706 (PubMed:15489334).Curated1
Sequence conflicti2019T → I in AK054654 (PubMed:14702039).Curated1
Sequence conflicti2702E → G in AAF36539 (Ref. 7) Curated1
Sequence conflicti2867S → T in AAF36539 (Ref. 7) Curated1
Sequence conflicti2896 – 2897KR → NA in AAF36539 (Ref. 7) Curated2
Sequence conflicti2902S → C in AAF36539 (Ref. 7) Curated1
Sequence conflicti3153S → P in AAF36539 (Ref. 7) Curated1
Sequence conflicti3182R → Q in AAF36539 (Ref. 7) Curated1
Sequence conflicti3191L → F in AAF36539 (Ref. 7) Curated1
Sequence conflicti3419 – 3420DR → YQ in AAF36539 (Ref. 7) Curated2
Sequence conflicti3665S → A in AAF36539 (Ref. 7) Curated1
Sequence conflicti3723P → T in AAH06270 (PubMed:15489334).Curated1
Sequence conflicti3726W → R in AAH06270 (PubMed:15489334).Curated1
Sequence conflicti3732 – 3733EP → DA in AAF36539 (Ref. 7) Curated2
Sequence conflicti3798E → R in AAF36539 (Ref. 7) Curated1
Sequence conflicti3830E → A in AAF36539 (Ref. 7) Curated1
Sequence conflicti3985C → G in AAF36539 (Ref. 7) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0474651M → MGSSAAAAAAAAAAADSAQW LSVKEETIFLHDGLIRVTDL AELPSEILGAPEAADTDLEI LTFETKNPSELAERLRSVCG NQSNAYARLLEYRLNALRGL WNAQRQLALEEQHERESSGD EETLALLKRQGLLQQPEQAP FTSRMGLLLVFPLIQSQSRT DPSLCNITAEVLLNCLRDCQ PLSLTKEPADCLNGIETLLC SWLEETSDTGRHIPHKQKEN AAAALVALACARGSLKTFVH TVHLLQKQTDLGSLPVADVL YRLLLLEGGPGSPSCLLGGK HIVSWGYEDMLPAPDSNTGS SSENKDADLGRCLTADGLYL YTTNSVGRGVSKLGSGLHGT LRGFVYCRNEELEPGWVAFG SGSLLHRPVSFDNKPHSLFQ VIDQNTLQVCQVVPM in isoform 5. 1 Publication1
Alternative sequenceiVSP_047466169R → ILASSLVYNISDGQFTSRAD LIDAAGSSLGRGALVPGLG in isoform 5. 1 Publication1
Alternative sequenceiVSP_039451483 – 484Missing in isoform 4. 1 Publication2
Alternative sequenceiVSP_039452717 – 726Missing in isoform 3, isoform 4 and isoform 5. 3 Publications10
Alternative sequenceiVSP_039453896 – 899EVIQ → YVAV in isoform 3 and isoform 5. 3 Publications4
Alternative sequenceiVSP_039454900 – 3996Missing in isoform 3 and isoform 5. 3 PublicationsAdd BLAST3097
Alternative sequenceiVSP_0345292382 – 2386NELVQ → SEQPF in isoform 2. 1 Publication5
Alternative sequenceiVSP_0345302387 – 3996Missing in isoform 2. 1 PublicationAdd BLAST1610

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB777655 mRNA Translation: BAM76724.1
AC073575 Genomic DNA No translation available.
AC004031 Genomic DNA No translation available.
AC004217 Genomic DNA No translation available.
BC006270 mRNA Translation: AAH06270.2
BC021144 mRNA Translation: AAH21144.1
BC065706 mRNA Translation: AAH65706.1 Sequence problems.
BC101482 mRNA Translation: AAI01483.1 Different initiation.
AK054654 mRNA No translation available.
AK091473 mRNA Translation: BAC03671.1 Different initiation.
AB014514 mRNA Translation: BAA31589.3 Sequence problems.
AF174498 mRNA Translation: AAF36539.1 Sequence problems.
AL117469 mRNA Translation: CAB55944.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T00390

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000430131; ENSP00000404379; ENSG00000173064

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB777655 mRNA Translation: BAM76724.1
AC073575 Genomic DNA No translation available.
AC004031 Genomic DNA No translation available.
AC004217 Genomic DNA No translation available.
BC006270 mRNA Translation: AAH06270.2
BC021144 mRNA Translation: AAH21144.1
BC065706 mRNA Translation: AAH65706.1 Sequence problems.
BC101482 mRNA Translation: AAI01483.1 Different initiation.
AK054654 mRNA No translation available.
AK091473 mRNA Translation: BAC03671.1 Different initiation.
AB014514 mRNA Translation: BAA31589.3 Sequence problems.
AF174498 mRNA Translation: AAF36539.1 Sequence problems.
AL117469 mRNA Translation: CAB55944.1
PIRiT00390

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

IntActiQ9Y4D8, 14 interactors
MINTiQ9Y4D8
STRINGi9606.ENSP00000449784

PTM databases

iPTMnetiQ9Y4D8
PhosphoSitePlusiQ9Y4D8

Polymorphism and mutation databases

BioMutaiHECTD4
DMDMi300669718

Proteomic databases

jPOSTiQ9Y4D8
MassIVEiQ9Y4D8
PaxDbiQ9Y4D8
PeptideAtlasiQ9Y4D8
PRIDEiQ9Y4D8
ProteomicsDBi86170 [Q9Y4D8-1]
86171 [Q9Y4D8-2]
86172 [Q9Y4D8-3]
86173 [Q9Y4D8-4]

Genome annotation databases

EnsembliENST00000430131; ENSP00000404379; ENSG00000173064

Organism-specific databases

DisGeNETi283450

GeneCards: human genes, protein and diseases

More...
GeneCardsi
HECTD4
HGNCiHGNC:26611 HECTD4
HPAiHPA041062
HPA045473
neXtProtiNX_Q9Y4D8

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1426 Eukaryota
COG5184 LUCA
InParanoidiQ9Y4D8
PhylomeDBiQ9Y4D8

Enzyme and pathway databases

UniPathwayiUPA00143

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
HECTD4 human
PharosiQ9Y4D8

Protein Ontology

More...
PROi
PR:Q9Y4D8

Family and domain databases

CDDicd00078 HECTc, 1 hit
cd13735 SPRY_HECT_like, 1 hit
InterProiView protein in InterPro
IPR000569 HECT_dom
IPR035983 Hect_E3_ubiquitin_ligase
IPR035781 SPRY_HECTD4
PfamiView protein in Pfam
PF00632 HECT, 1 hit
SMARTiView protein in SMART
SM00119 HECTc, 1 hit
SUPFAMiSSF56204 SSF56204, 1 hit
PROSITEiView protein in PROSITE
PS50237 HECT, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHECD4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y4D8
Secondary accession number(s): L8B0P6
, Q3MJD5, Q6P0A0, Q7L530, Q8NB70, Q8WU73, Q96NT9, Q9NZS4, Q9UFT6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 2008
Last sequence update: July 13, 2010
Last modified: October 16, 2019
This is version 137 of the entry and version 5 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again