Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Neurexin-3

Gene

NRXN3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Neuronal cell surface protein that may be involved in cell recognition and cell adhesion. May mediate intracellular signaling.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi304CalciumBy similarity1
Metal bindingi321Calcium; via carbonyl oxygenBy similarity1
Metal bindingi374Calcium; via carbonyl oxygenBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • adult behavior Source: BHF-UCL
  • axon guidance Source: ProtInc
  • learning Source: BHF-UCL
  • neuron cell-cell adhesion Source: BHF-UCL
  • social behavior Source: BHF-UCL
  • vocalization behavior Source: BHF-UCL

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion
LigandCalcium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6794361 Neurexins and neuroligins

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9Y4C0

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Neurexin-3
Alternative name(s):
Neurexin III-alpha
Neurexin-3-alpha
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NRXN3
Synonyms:C14orf60, KIAA0743
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000021645.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:8010 NRXN3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600567 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y4C0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini28 – 1568ExtracellularSequence analysisAdd BLAST1541
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1569 – 1589HelicalSequence analysisAdd BLAST21
Topological domaini1590 – 1643CytoplasmicSequence analysisAdd BLAST54

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9369

Open Targets

More...
OpenTargetsi
ENSG00000021645

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31788

Polymorphism and mutation databases

Domain mapping of disease mutations (DMDM)

More...
DMDMi
224471902

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 27By similarityAdd BLAST27
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001949928 – 1643Neurexin-3Add BLAST1616

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi58N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi105N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi202 ↔ 213By similarity
Disulfide bondi207 ↔ 222By similarity
Disulfide bondi224 ↔ 234By similarity
Disulfide bondi404 ↔ 440By similarity
Disulfide bondi610 ↔ 639By similarity
Disulfide bondi647 ↔ 658By similarity
Disulfide bondi652 ↔ 667By similarity
Disulfide bondi669 ↔ 679By similarity
Glycosylationi757N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1018 ↔ 1046By similarity
Disulfide bondi1053 ↔ 1064By similarity
Disulfide bondi1058 ↔ 1073By similarity
Disulfide bondi1075 ↔ 1085By similarity
Glycosylationi1189N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1257N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1301N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9Y4C0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y4C0

PeptideAtlas

More...
PeptideAtlasi
Q9Y4C0

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y4C0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
86154
86155 [Q9Y4C0-3]
86156 [Q9Y4C0-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y4C0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y4C0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the blood vessel walls (at protein level). Highly expressed in brain, lung, and pancreas; a lower level of expression is detectable in heart, placenta, liver, and kidney, whereas no expression can be observed in skeletal muscle. Isoform 4a is heart-specific.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000021645 Expressed in 177 organ(s), highest expression level in cerebellar vermis

CleanEx database of gene expression profiles

More...
CleanExi
HS_NRXN3

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9Y4C0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Y4C0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA002727

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

The laminin G-like domain 2 binds to NXPH1. Specific isoforms bind to alpha-dystroglycan. The cytoplasmic C-terminal region binds to CASK (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114770, 14 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q9Y4C0

Protein interaction database and analysis system

More...
IntActi
Q9Y4C0, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000338349

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9Y4C0

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Y4C0

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini28 – 202Laminin G-like 1PROSITE-ProRule annotationAdd BLAST175
Domaini198 – 235EGF-like 1PROSITE-ProRule annotationAdd BLAST38
Domaini258 – 440Laminin G-like 2PROSITE-ProRule annotationAdd BLAST183
Domaini447 – 639Laminin G-like 3PROSITE-ProRule annotationAdd BLAST193
Domaini643 – 680EGF-like 2PROSITE-ProRule annotationAdd BLAST38
Domaini685 – 857Laminin G-like 4PROSITE-ProRule annotationAdd BLAST173
Domaini871 – 1046Laminin G-like 5PROSITE-ProRule annotationAdd BLAST176
Domaini1049 – 1086EGF-like 3PROSITE-ProRule annotationAdd BLAST38
Domaini1090 – 1260Laminin G-like 6PROSITE-ProRule annotationAdd BLAST171

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the neurexin family.Curated

Keywords - Domaini

EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3514 Eukaryota
ENOG410XNU6 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154618

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG052670

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y4C0

Database of Orthologous Groups

More...
OrthoDBi
EOG091G00KC

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y4C0

TreeFam database of animal gene trees

More...
TreeFami
TF321302

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013320 ConA-like_dom_sf
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR001791 Laminin_G
IPR037440 Neurexin
IPR003585 Neurexin-like
IPR027789 Syndecan/Neurexin_dom

The PANTHER Classification System

More...
PANTHERi
PTHR44287 PTHR44287, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00008 EGF, 1 hit
PF02210 Laminin_G_2, 6 hits
PF01034 Syndecan, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00294 4.1m, 1 hit
SM00181 EGF, 3 hits
SM00282 LamG, 6 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49899 SSF49899, 6 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00010 ASX_HYDROXYL, 1 hit
PS50026 EGF_3, 3 hits
PS50025 LAM_G_DOMAIN, 6 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket
Note: A number of isoforms, alpha-type and beta-type, are produced by alternative promoter usage. Beta-type isoforms differ from alpha-type isoforms in their N-terminus. Additional isoforms produced by alternative splicing seem to exist.1 Publication

This entry has 7 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1a (identifier: Q9Y4C0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSTLHSVFF TLKVSILLGS LLGLCLGLEF MGLPNQWARY LRWDASTRSD
60 70 80 90 100
LSFQFKTNVS TGLLLYLDDG GVCDFLCLSL VDGRVQLRFS MDCAETAVLS
110 120 130 140 150
NKQVNDSSWH FLMVSRDRLR TVLMLDGEGQ SGELQPQRPY MDVVSDLFLG
160 170 180 190 200
GVPTDIRPSA LTLDGVQAMP GFKGLILDLK YGNSEPRLLG SRGVQMDAEG
210 220 230 240 250
PCGERPCENG GICFLLDGHP TCDCSTTGYG GKLCSEDVSQ DPGLSHLMMS
260 270 280 290 300
EQAREENVAT FRGSEYLCYD LSQNPIQSSS DEITLSFKTW QRNGLILHTG
310 320 330 340 350
KSADYVNLAL KDGAVSLVIN LGSGAFEAIV EPVNGKFNDN AWHDVKVTRN
360 370 380 390 400
LRQVTISVDG ILTTTGYTQE DYTMLGSDDF FYVGGSPSTA DLPGSPVSNN
410 420 430 440 450
FMGCLKEVVY KNNDIRLELS RLARIADTKM KIYGEVVFKC ENVATLDPIN
460 470 480 490 500
FETPEAYISL PKWNTKRMGS ISFDFRTTEP NGLILFTHGK PQERKDARSQ
510 520 530 540 550
KNTKVDFFAV ELLDGNLYLL LDMGSGTIKV KATQKKANDG EWYHVDIQRD
560 570 580 590 600
GRSGTISVNS RRTPFTASGE SEILDLEGDM YLGGLPENRA GLILPTELWT
610 620 630 640 650
AMLNYGYVGC IRDLFIDGRS KNIRQLAEMQ NAAGVKSSCS RMSAKQCDSY
660 670 680 690 700
PCKNNAVCKD GWNRFICDCT GTGYWGRTCE REASILSYDG SMYMKIIMPM
710 720 730 740 750
VMHTEAEDVS FRFMSQRAYG LLVATTSRDS ADTLRLELDG GRVKLMVNLD
760 770 780 790 800
CIRINCNSSK GPETLYAGQK LNDNEWHTVR VVRRGKSLKL TVDDDVAEGT
810 820 830 840 850
MVGDHTRLEF HNIETGIMTE KRYISVVPSS FIGHLQSLMF NGLLYIDLCK
860 870 880 890 900
NGDIDYCELK ARFGLRNIIA DPVTFKTKSS YLSLATLQAY TSMHLFFQFK
910 920 930 940 950
TTSPDGFILF NSGDGNDFIA VELVKGYIHY VFDLGNGPNV IKGNSDRPLN
960 970 980 990 1000
DNQWHNVVIT RDNSNTHSLK VDTKVVTQVI NGAKNLDLKG DLYMAGLAQG
1010 1020 1030 1040 1050
MYSNLPKLVA SRDGFQGCLA SVDLNGRLPD LINDALHRSG QIERGCEGPS
1060 1070 1080 1090 1100
TTCQEDSCAN QGVCMQQWEG FTCDCSMTSY SGNQCNDPGA TYIFGKSGGL
1110 1120 1130 1140 1150
ILYTWPANDR PSTRSDRLAV GFSTTVKDGI LVRIDSAPGL GDFLQLHIEQ
1160 1170 1180 1190 1200
GKIGVVFNIG TVDISIKEER TPVNDGKYHV VRFTRNGGNA TLQVDNWPVN
1210 1220 1230 1240 1250
EHYPTGRQLT IFNTQAQIAI GGKDKGRLFQ GQLSGLYYDG LKVLNMAAEN
1260 1270 1280 1290 1300
NPNIKINGSV RLVGEVPSIL GTTQTTSMPP EMSTTVMETT TTMATTTTRK
1310 1320 1330 1340 1350
NRSTASIQPT SDDLVSSAEC SSDDEDFVEC EPSTTGGELV IPLLVEDPLA
1360 1370 1380 1390 1400
TPPIATRAPS ITLPPTFRPL LTIIETTKDS LSMTSEAGLP CLSDQGSDGC
1410 1420 1430 1440 1450
DDDGLVISGY GSGETFDSNL PPTDDEDFYT TFSLVTDKSL STSIFEGGYK
1460 1470 1480 1490 1500
AHAPKWESKD FRPNKVSETS RTTTTSLSPE LIRFTASSSS GMVPKLPAGK
1510 1520 1530 1540 1550
MNNRDLKPQP DIVLLPLPTA YELDSTKLKS PLITSPMFRN VPTANPTEPG
1560 1570 1580 1590 1600
IRRVPGASEV IRESSSTTGM VVGIVAAAAL CILILLYAMY KYRNRDEGSY
1610 1620 1630 1640
QVDETRNYIS NSAQSNGTLM KEKQQSSKSG HKKQKNKDRE YYV
Length:1,643
Mass (Da):180,599
Last modified:March 3, 2009 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE7360348E263C6EC
GO
Isoform 3a (identifier: Q9Y4C0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-373: Missing.
     1334-1542: Missing.

Note: Produced by alternative splicing.
Show »
Length:1,061
Mass (Da):117,317
Checksum:i5BB0495CAE63A1AD
GO
Isoform 4a (identifier: Q9Y4C0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     237-242: Missing.
     252-252: Q → QGRSK
     750-759: DCIRINCNSS → G
     1205-1205: T → TGNTDNERFQMVKQKIPFKYNRPVEEWLQEK
     1335-1373: TGGELVIPLL...PPTFRPLLTI → GRSARSSNAA...IIFISCVVHS
     1374-1643: Missing.

Note: Produced by alternative splicing.
Show »
Length:1,392
Mass (Da):153,885
Checksum:i32D1B3F77340C23D
GO
Isoform 1b (identifier: Q9HDB5-1) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q9HDB5.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:637
Mass (Da):69,305
GO
Isoform 2b (identifier: Q9HDB5-2) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q9HDB5.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative splicing.
Length:432
Mass (Da):47,270
GO
Isoform 3b (identifier: Q9HDB5-3) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q9HDB5.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative splicing. No experimental confirmation available.
Length:396
Mass (Da):43,766
GO
Isoform 4b (identifier: Q9HDB5-4) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q9HDB5.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative splicing.
Length:459
Mass (Da):50,705
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0U1RRJ0A0A0U1RRJ0_HUMAN
Neurexin-3-beta
NRXN3
1,571Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DGK4A0A0C4DGK4_HUMAN
Neurexin-3-beta
NRXN3
398Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RQC5A0A0U1RQC5_HUMAN
Neurexin-3-beta
NRXN3
1,664Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MR89A0A0A0MR89_HUMAN
Neurexin-3-beta
NRXN3
879Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V247G3V247_HUMAN
Neurexin-3-beta
NRXN3
119Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJL2H0YJL2_HUMAN
Neurexin-3-beta
NRXN3
175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V4R9G3V4R9_HUMAN
Neurexin-3-beta
NRXN3
75Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA34463 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1043E → K in BAA34463 (PubMed:9872452).Curated1
Sequence conflicti1043E → K in AAI52458 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0364631 – 373Missing in isoform 3a. 2 PublicationsAdd BLAST373
Alternative sequenceiVSP_041699237 – 242Missing in isoform 4a. 1 Publication6
Alternative sequenceiVSP_041700252Q → QGRSK in isoform 4a. 1 Publication1
Alternative sequenceiVSP_041701750 – 759DCIRINCNSS → G in isoform 4a. 1 Publication10
Alternative sequenceiVSP_0417021205T → TGNTDNERFQMVKQKIPFKY NRPVEEWLQEK in isoform 4a. 1 Publication1
Alternative sequenceiVSP_0364641334 – 1542Missing in isoform 3a. 2 PublicationsAdd BLAST209
Alternative sequenceiVSP_0417031335 – 1373TGGEL…PLLTI → GRSARSSNAARSLRAALTWT WRLTYTFTPIIFISCVVHS in isoform 4a. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_0417041374 – 1643Missing in isoform 4a. 1 PublicationAdd BLAST270

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ316284 mRNA Translation: CAC87720.2
AF099810 Genomic DNA Translation: AAC68909.1
AF123462 Genomic DNA Translation: AAD13621.1
AB018286 mRNA Translation: BAA34463.2 Different initiation.
AC008056 Genomic DNA Translation: AAF09143.1
AC012099 Genomic DNA Translation: AAF15058.1
AC009396 Genomic DNA Translation: AAF21147.1
AC008045 Genomic DNA Translation: AAF28465.1
AC011440 Genomic DNA Translation: AAF61277.1
AC026888 Genomic DNA Translation: AAF87841.1
CH471061 Genomic DNA Translation: EAW81316.1
BC152457 mRNA Translation: AAI52458.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS9870.1 [Q9Y4C0-3]

NCBI Reference Sequences

More...
RefSeqi
NP_004787.2, NM_004796.5 [Q9Y4C0-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.368307

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000554719; ENSP00000451648; ENSG00000021645 [Q9Y4C0-3]
ENST00000554738; ENSP00000450683; ENSG00000021645 [Q9Y4C0-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9369

UCSC genome browser

More...
UCSCi
uc001xun.5 human [Q9Y4C0-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ316284 mRNA Translation: CAC87720.2
AF099810 Genomic DNA Translation: AAC68909.1
AF123462 Genomic DNA Translation: AAD13621.1
AB018286 mRNA Translation: BAA34463.2 Different initiation.
AC008056 Genomic DNA Translation: AAF09143.1
AC012099 Genomic DNA Translation: AAF15058.1
AC009396 Genomic DNA Translation: AAF21147.1
AC008045 Genomic DNA Translation: AAF28465.1
AC011440 Genomic DNA Translation: AAF61277.1
AC026888 Genomic DNA Translation: AAF87841.1
CH471061 Genomic DNA Translation: EAW81316.1
BC152457 mRNA Translation: AAI52458.1
CCDSiCCDS9870.1 [Q9Y4C0-3]
RefSeqiNP_004787.2, NM_004796.5 [Q9Y4C0-3]
UniGeneiHs.368307

3D structure databases

ProteinModelPortaliQ9Y4C0
SMRiQ9Y4C0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114770, 14 interactors
ELMiQ9Y4C0
IntActiQ9Y4C0, 1 interactor
STRINGi9606.ENSP00000338349

PTM databases

iPTMnetiQ9Y4C0
PhosphoSitePlusiQ9Y4C0

Polymorphism and mutation databases

DMDMi224471902

Proteomic databases

MaxQBiQ9Y4C0
PaxDbiQ9Y4C0
PeptideAtlasiQ9Y4C0
PRIDEiQ9Y4C0
ProteomicsDBi86154
86155 [Q9Y4C0-3]
86156 [Q9Y4C0-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000554719; ENSP00000451648; ENSG00000021645 [Q9Y4C0-3]
ENST00000554738; ENSP00000450683; ENSG00000021645 [Q9Y4C0-4]
GeneIDi9369
UCSCiuc001xun.5 human [Q9Y4C0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9369
DisGeNETi9369
EuPathDBiHostDB:ENSG00000021645.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NRXN3
HGNCiHGNC:8010 NRXN3
HPAiHPA002727
MIMi600567 gene
neXtProtiNX_Q9Y4C0
OpenTargetsiENSG00000021645
PharmGKBiPA31788

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3514 Eukaryota
ENOG410XNU6 LUCA
GeneTreeiENSGT00940000154618
HOVERGENiHBG052670
InParanoidiQ9Y4C0
OrthoDBiEOG091G00KC
PhylomeDBiQ9Y4C0
TreeFamiTF321302

Enzyme and pathway databases

ReactomeiR-HSA-6794361 Neurexins and neuroligins
SIGNORiQ9Y4C0

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NRXN3 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9369

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000021645 Expressed in 177 organ(s), highest expression level in cerebellar vermis
CleanExiHS_NRXN3
ExpressionAtlasiQ9Y4C0 baseline and differential
GenevisibleiQ9Y4C0 HS

Family and domain databases

InterProiView protein in InterPro
IPR013320 ConA-like_dom_sf
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR001791 Laminin_G
IPR037440 Neurexin
IPR003585 Neurexin-like
IPR027789 Syndecan/Neurexin_dom
PANTHERiPTHR44287 PTHR44287, 1 hit
PfamiView protein in Pfam
PF00008 EGF, 1 hit
PF02210 Laminin_G_2, 6 hits
PF01034 Syndecan, 1 hit
SMARTiView protein in SMART
SM00294 4.1m, 1 hit
SM00181 EGF, 3 hits
SM00282 LamG, 6 hits
SUPFAMiSSF49899 SSF49899, 6 hits
PROSITEiView protein in PROSITE
PS00010 ASX_HYDROXYL, 1 hit
PS50026 EGF_3, 3 hits
PS50025 LAM_G_DOMAIN, 6 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNRX3A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y4C0
Secondary accession number(s): A6NGR4
, A7MD34, O95378, Q8IUE3, Q9NS47, Q9P1V3, Q9P1V6, Q9UIE2, Q9UIE3, Q9ULA5, Q9Y486
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: March 3, 2009
Last modified: December 5, 2018
This is version 181 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again