Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 147 (29 Sep 2021)
Sequence version 5 (18 Apr 2012)
Previous versions | rss
Add a publicationFeedback
Protein

Microtubule cross-linking factor 1

Gene

MTCL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Microtubule-associated factor involved in the late phase of epithelial polarization and microtubule dynamics regulation. Plays a role in the development and maintenance of non-centrosomal microtubule bundles at the lateral membrane in polarized epithelial cells.

1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9Y4B5

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Microtubule cross-linking factor 1
Alternative name(s):
Coiled-coil domain-containing protein 165
PAR-1-interacting protein
SOGA family member 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MTCL1
Synonyms:CCDC165, KIAA0802, SOGA2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 18

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29121, MTCL1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615766, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y4B5

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000168502

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
23255

Open Targets

More...
OpenTargetsi
ENSG00000168502

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA128394616

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9Y4B5, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MTCL1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
384872711

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002801131 – 1905Microtubule cross-linking factor 1Add BLAST1905

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei77PhosphoserineCombined sources1
Modified residuei87PhosphoserineCombined sources1
Modified residuei217PhosphoserineBy similarity1
Modified residuei221PhosphoserineBy similarity1
Modified residuei263PhosphoserineCombined sources1
Modified residuei549PhosphoserineCombined sources1
Modified residuei618PhosphoserineCombined sources1
Modified residuei621PhosphothreonineCombined sources1
Modified residuei685PhosphoserineCombined sources1
Modified residuei776PhosphoserineCombined sources1
Modified residuei901PhosphoserineCombined sources1
Modified residuei923PhosphoserineCombined sources1
Modified residuei1278PhosphoserineCombined sources1
Modified residuei1385PhosphoserineCombined sources1
Modified residuei1388PhosphoserineCombined sources1
Modified residuei1399PhosphoserineCombined sources1
Modified residuei1417PhosphothreonineCombined sources1
Modified residuei1421PhosphoserineCombined sources1
Modified residuei1427PhosphotyrosineCombined sources1
Modified residuei1514PhosphoserineCombined sources1
Modified residuei1523PhosphoserineCombined sources1
Modified residuei1561PhosphoserineCombined sources1
Modified residuei1578PhosphoserineCombined sources1
Modified residuei1583PhosphoserineCombined sources1
Modified residuei1592PhosphoserineCombined sources1
Modified residuei1661PhosphoserineCombined sources1
Modified residuei1667PhosphothreonineCombined sources1
Modified residuei1675PhosphothreonineCombined sources1
Modified residuei1679PhosphoserineCombined sources1
Modified residuei1683PhosphoserineCombined sources1
Modified residuei1791PhosphoserineCombined sources1
Modified residuei1808PhosphoserineCombined sources1
Modified residuei1812PhosphoserineCombined sources1
Modified residuei1814PhosphoserineCombined sources1
Isoform 4 (identifier: Q9Y4B5-4)
Modified residuei941PhosphoserineCombined sources1
Modified residuei975PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9Y4B5

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9Y4B5

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9Y4B5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y4B5

PeptideAtlas

More...
PeptideAtlasi
Q9Y4B5

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y4B5

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
86147 [Q9Y4B5-1]
86148 [Q9Y4B5-2]
86149 [Q9Y4B5-3]
86150 [Q9Y4B5-4]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q9Y4B5, 2 sites, 1 O-linked glycan (2 sites)

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y4B5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y4B5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000168502, Expressed in right hemisphere of cerebellum and 199 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9Y4B5, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Y4B5, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000168502, Tissue enriched (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Isoform 1 interacts with MARK2; the interaction increases MARK2 microtubule-binding ability (By similarity). Homodimer. Associates (via N- and C-terminus domains) with microtubule filaments.

Isoform 2 interacts with MARK2; the interaction is direct.

By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
116859, 57 interactors

Protein interaction database and analysis system

More...
IntActi
Q9Y4B5, 36 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000352927

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9Y4B5, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Y4B5

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 508Necessary for self-assembly, microtubule bundling activity and apicobasal microtubule organizationBy similarityAdd BLAST508
Regioni1 – 329DisorderedSequence analysisAdd BLAST329
Regioni1 – 249Necessary for colocalization and binding with microtubulesBy similarityAdd BLAST249
Regioni544 – 563DisorderedSequence analysisAdd BLAST20
Regioni601 – 631DisorderedSequence analysisAdd BLAST31
Regioni671 – 694DisorderedSequence analysisAdd BLAST24
Regioni737 – 800DisorderedSequence analysisAdd BLAST64
Regioni842 – 867DisorderedSequence analysisAdd BLAST26
Regioni1080 – 1100DisorderedSequence analysisAdd BLAST21
Regioni1265 – 1382Necessary for interaction with MARK2 and apicobasal microtubule bundle formation in polarized epithelial cells1 PublicationAdd BLAST118
Regioni1346 – 1384DisorderedSequence analysisAdd BLAST39
Regioni1485 – 1505DisorderedSequence analysisAdd BLAST21
Regioni1524 – 1569DisorderedSequence analysisAdd BLAST46
Regioni1655 – 1689DisorderedSequence analysisAdd BLAST35
Regioni1678 – 1773Necessary for colocalization and binding with microtubulesAdd BLAST96
Regioni1707 – 1756DisorderedSequence analysisAdd BLAST50
Regioni1782 – 1842DisorderedSequence analysisAdd BLAST61
Regioni1863 – 1905DisorderedSequence analysisAdd BLAST43

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili330 – 404Sequence analysisAdd BLAST75
Coiled coili432 – 483Sequence analysisAdd BLAST52
Coiled coili513 – 718Sequence analysisAdd BLAST206
Coiled coili1143 – 1201Sequence analysisAdd BLAST59
Coiled coili1238 – 1278Sequence analysisAdd BLAST41

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi21 – 35Basic residuesSequence analysisAdd BLAST15
Compositional biasi197 – 217Polar residuesSequence analysisAdd BLAST21
Compositional biasi247 – 268Pro residuesSequence analysisAdd BLAST22
Compositional biasi741 – 782Basic and acidic residuesSequence analysisAdd BLAST42
Compositional biasi1352 – 1379Basic and acidic residuesSequence analysisAdd BLAST28
Compositional biasi1485 – 1503Polar residuesSequence analysisAdd BLAST19
Compositional biasi1722 – 1756Polar residuesSequence analysisAdd BLAST35

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SOGA family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4787, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182982

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_002595_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y4B5

Identification of Orthologs from Complete Genome Data

More...
OMAi
KDLHARP

Database of Orthologous Groups

More...
OrthoDBi
34629at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y4B5

TreeFam database of animal gene trees

More...
TreeFami
TF331853

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027882, DUF4482
IPR027881, SOGA

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF14818, DUF4482, 1 hit
PF11365, SOGA, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y4B5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
METLNGPAGG GAPDAKLQPP GQHHRHHHLH PVAERRRLHR APSPARPFLK
60 70 80 90 100
DLHARPAAPG PAVPSSGRAP APAAPRSPNL AGKAPPSPGS LAAPGRLSRR
110 120 130 140 150
SGGVPGAKDK PPPGAGARAA GGAKAALGSR RAARVAPAEP LSRAGKPPGA
160 170 180 190 200
EPPSAAAKGR KAKRGSRAPP ARTVGPPTPA ARIPAVTLAV TSVAGSPARC
210 220 230 240 250
SRISHTDSSS DLSDCPSEPL SDEQRLLPAA SSDAESGTGS SDREPPRGAP
260 270 280 290 300
TPSPAARGAP PGSPEPPALL AAPLAAGACP GGRSIPSGVS GGFAGPGVAE
310 320 330 340 350
DVRGRSPPER PVPGTPKEPS LGEQSRLVPA AEEEELLREM EELRSENDYL
360 370 380 390 400
KDELDELRAE MEEMRDSYLE EDVYQLQELR RELDRANKNC RILQYRLRKA
410 420 430 440 450
EQKSLKVAET GQVDGELIRS LEQDLKVAKD VSVRLHHELK TVEEKRAKAE
460 470 480 490 500
DENETLRQQM IEVEISKQAL QNELERLKES SLKRRSTREM YKEKKTFNQD
510 520 530 540 550
DSADLRCQLQ FAKEEAFLMR KKMAKLGREK DELEQELQKY KSLYGDVDSP
560 570 580 590 600
LPTGEAGGPP STREAELKLR LKLVEEEANI LGRKIVELEV ENRGLKAEME
610 620 630 640 650
DMRGQQEREG PGRDHAPSIP TSPFGDSLES STELRRHLQF VEEEAELLRR
660 670 680 690 700
SISEIEDHNR QLTHELSKFK FEPPREPGWL GEGASPGAGG GAPLQEELKS
710 720 730 740 750
ARLQISELSG KVLKLQHENH ALLSNIQRCD LAAHLGLRAP SPRDSDAESD
760 770 780 790 800
AGKKESDGEE SRLPQPKREG PVGGESDSEE MFEKTSGFGS GKPSEASEPC
810 820 830 840 850
PTELLKARED SEYLVTLKHE AQRLERTVER LITDTDSFLH DAGLRGGAPL
860 870 880 890 900
PGPGLQGEEE QGEGDQQEPQ LLGTINAKMK AFKKELQAFL EQVNRIGDGL
910 920 930 940 950
SPLPHLTESS SFLSTVTSVS RDSPIGNLGK ELGPDLQSRL KEQLEWQLGP
960 970 980 990 1000
ARGDERESLR LRAARELHRR ADGDTGSHGL GGQTCFSLEM EEEHLYALRW
1010 1020 1030 1040 1050
KELEMHSLAL QNTLHERTWS DEKNLMQQEL RSLKQNIFLF YVKLRWLLKH
1060 1070 1080 1090 1100
WRQGKQMEEE GEEFTEGEHP ETLSRLGELG VQGGHQADGP DHDSDRGCGF
1110 1120 1130 1140 1150
PVGEHSPHSR VQIGDHSLRL QTADRGQPHK QVVENQQLFS AFKALLEDFR
1160 1170 1180 1190 1200
AELREDERAR LRLQQQYASD KAAWDVEWAV LKCRLEQLEE KTENKLGELG
1210 1220 1230 1240 1250
SSAESKGALK KEREVHQKLL ADSHSLVMDL RWQIHHSEKN WNREKVELLD
1260 1270 1280 1290 1300
RLDRDRQEWE RQKKEFLWRI EQLQKENSPR RGGSFLCDQK DGNVRPFPHQ
1310 1320 1330 1340 1350
GSLRMPRPVA MWPCADADSI PFEDRPLSKL KESDRCSASE NLYLDALSLD
1360 1370 1380 1390 1400
DEPEEPPAHR PEREFRNRLP EEEENHKGNL QRAVSVSSMS EFQRLMDISP
1410 1420 1430 1440 1450
FLPEKGLPST SSKEDVTPPL SPDDLKYIEE FNKSWDYTPN RGHNGGGPDL
1460 1470 1480 1490 1500
WADRTEVGRA GHEDSTEPFP DSSWYLTTSV TMTTDTMTSP EHCQKQPLRS
1510 1520 1530 1540 1550
HVLTEQSGLR VLHSPPAVRR VDSITAAGGE GPFPTSRARG SPGDTKGGPP
1560 1570 1580 1590 1600
EPMLSRWPCT SPRHSRDYVE GARRPLDSPL CTSLGFASPL HSLEMSKNLS
1610 1620 1630 1640 1650
DDMKEVAFSV RNAICSGPGE LQVKDMACQT NGSRTMGTQT VQTISVGLQT
1660 1670 1680 1690 1700
EALRGSGVTS SPHKCLTPKA GGGATPVSSP SRSLRSRQVA PAIEKVQAKF
1710 1720 1730 1740 1750
ERTCCSPKYG SPKLQRKPLP KADQPNNRTS PGMAQKGYSE SAWARSTTTR
1760 1770 1780 1790 1800
ESPVHTTIND GLSSLFNIID HSPVVQDPFQ KGLRAGSRSR SAEPRPELGP
1810 1820 1830 1840 1850
GQETGTNSRG RSPSPIGVGS EMCREEGGEG TPVKQDLSAP PGYTLTENVA
1860 1870 1880 1890 1900
RILNKKLLEH ALKEERRQAA HGPPGLHSDS HSLGDTAEPG PMENQTVLLT

APWGL
Length:1,905
Mass (Da):209,526
Last modified:April 18, 2012 - v5
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBD7455BB2B822CE0
GO
Isoform 2 (identifier: Q9Y4B5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-360: Missing.

Show »
Length:1,545
Mass (Da):173,310
Checksum:iDF457AEFCFAFB40A
GO
Isoform 3 (identifier: Q9Y4B5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-360: Missing.
     989-989: E → ELRGPPVLPEQSVSIEELQGQLVQAARLHQEETETFTNKIHK

Show »
Length:1,586
Mass (Da):177,945
Checksum:i1D44ACAC4C4977A3
GO
Isoform 4 (identifier: Q9Y4B5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1004: Missing.
     1187-1187: Q → QNCCGYPRINIEEETLGFTRLPAGSTVKTLKSLGLQRLE
     1273-1300: Missing.
     1894-1905: NQTVLLTAPWGL → ELPCSALAPS...LHGLSQYNSL

Show »
Length:976
Mass (Da):108,707
Checksum:iF49E33A334D49052
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3QL92J3QL92_HUMAN
Microtubule cross-linking factor 1
MTCL1
509Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QLE1J3QLE1_HUMAN
Microtubule cross-linking factor 1
MTCL1
47Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA34522 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_055942602M → T. Corresponds to variant dbSNP:rs35739383Ensembl.1
Natural variantiVAR_031073861Q → R1 PublicationCorresponds to variant dbSNP:rs1965665Ensembl.1
Natural variantiVAR_031074898D → GCombined sources1 PublicationCorresponds to variant dbSNP:rs3744979Ensembl.1
Natural variantiVAR_0310751097G → S1 PublicationCorresponds to variant dbSNP:rs12386117Ensembl.1
Natural variantiVAR_0310761211K → Q. Corresponds to variant dbSNP:rs11874468Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0235491 – 1004Missing in isoform 4. 1 PublicationAdd BLAST1004
Alternative sequenceiVSP_0235501 – 360Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST360
Alternative sequenceiVSP_023551989E → ELRGPPVLPEQSVSIEELQG QLVQAARLHQEETETFTNKI HK in isoform 3. 1 Publication1
Alternative sequenceiVSP_0235521187Q → QNCCGYPRINIEEETLGFTR LPAGSTVKTLKSLGLQRLE in isoform 4. 1 Publication1
Alternative sequenceiVSP_0235531273 – 1300Missing in isoform 4. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_0235541894 – 1905NQTVL…APWGL → ELPCSALAPSLEPCFSRPER PANRRPPSRWAPHSPTASQP QSPGDPTSLEEHGGEEPPEE QPHRDASLHGLSQYNSL in isoform 4. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB018345 mRNA Translation: BAA34522.2 Different initiation.
AK131528 mRNA Translation: BAD18666.1
AP000864 Genomic DNA No translation available.
AP001531 Genomic DNA No translation available.
BC040542 mRNA Translation: AAH40542.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11841.1 [Q9Y4B5-3]

NCBI Reference Sequences

More...
RefSeqi
NP_056025.2, NM_015210.3 [Q9Y4B5-3]
XP_005258156.1, XM_005258099.4

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000306329; ENSP00000305027; ENSG00000168502 [Q9Y4B5-1]
ENST00000359865; ENSP00000352927; ENSG00000168502 [Q9Y4B5-3]
ENST00000400050; ENSP00000382924; ENSG00000168502 [Q9Y4B5-3]
ENST00000517570; ENSP00000429556; ENSG00000168502 [Q9Y4B5-2]
ENST00000518815; ENSP00000463465; ENSG00000168502 [Q9Y4B5-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23255

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23255

UCSC genome browser

More...
UCSCi
uc002knq.2, human [Q9Y4B5-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB018345 mRNA Translation: BAA34522.2 Different initiation.
AK131528 mRNA Translation: BAD18666.1
AP000864 Genomic DNA No translation available.
AP001531 Genomic DNA No translation available.
BC040542 mRNA Translation: AAH40542.2
CCDSiCCDS11841.1 [Q9Y4B5-3]
RefSeqiNP_056025.2, NM_015210.3 [Q9Y4B5-3]
XP_005258156.1, XM_005258099.4

3D structure databases

SMRiQ9Y4B5
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi116859, 57 interactors
IntActiQ9Y4B5, 36 interactors
STRINGi9606.ENSP00000352927

PTM databases

GlyGeniQ9Y4B5, 2 sites, 1 O-linked glycan (2 sites)
iPTMnetiQ9Y4B5
PhosphoSitePlusiQ9Y4B5

Genetic variation databases

BioMutaiMTCL1
DMDMi384872711

Proteomic databases

EPDiQ9Y4B5
jPOSTiQ9Y4B5
MassIVEiQ9Y4B5
PaxDbiQ9Y4B5
PeptideAtlasiQ9Y4B5
PRIDEiQ9Y4B5
ProteomicsDBi86147 [Q9Y4B5-1]
86148 [Q9Y4B5-2]
86149 [Q9Y4B5-3]
86150 [Q9Y4B5-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
48434, 30 antibodies

The DNASU plasmid repository

More...
DNASUi
23255

Genome annotation databases

EnsembliENST00000306329; ENSP00000305027; ENSG00000168502 [Q9Y4B5-1]
ENST00000359865; ENSP00000352927; ENSG00000168502 [Q9Y4B5-3]
ENST00000400050; ENSP00000382924; ENSG00000168502 [Q9Y4B5-3]
ENST00000517570; ENSP00000429556; ENSG00000168502 [Q9Y4B5-2]
ENST00000518815; ENSP00000463465; ENSG00000168502 [Q9Y4B5-4]
GeneIDi23255
KEGGihsa:23255
UCSCiuc002knq.2, human [Q9Y4B5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23255
DisGeNETi23255

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MTCL1
HGNCiHGNC:29121, MTCL1
HPAiENSG00000168502, Tissue enriched (brain)
MIMi615766, gene
neXtProtiNX_Q9Y4B5
OpenTargetsiENSG00000168502
PharmGKBiPA128394616
VEuPathDBiHostDB:ENSG00000168502

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4787, Eukaryota
GeneTreeiENSGT00950000182982
HOGENOMiCLU_002595_0_0_1
InParanoidiQ9Y4B5
OMAiKDLHARP
OrthoDBi34629at2759
PhylomeDBiQ9Y4B5
TreeFamiTF331853

Enzyme and pathway databases

PathwayCommonsiQ9Y4B5

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
23255, 3 hits in 1014 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MTCL1, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
KIAA0802

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23255
PharosiQ9Y4B5, Tbio

Protein Ontology

More...
PROi
PR:Q9Y4B5
RNActiQ9Y4B5, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000168502, Expressed in right hemisphere of cerebellum and 199 other tissues
ExpressionAtlasiQ9Y4B5, baseline and differential
GenevisibleiQ9Y4B5, HS

Family and domain databases

InterProiView protein in InterPro
IPR027882, DUF4482
IPR027881, SOGA
PfamiView protein in Pfam
PF14818, DUF4482, 1 hit
PF11365, SOGA, 2 hits

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMTCL1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y4B5
Secondary accession number(s): E9PAY7, Q6ZMQ9, Q8IWA9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 6, 2007
Last sequence update: April 18, 2012
Last modified: September 29, 2021
This is version 147 of the entry and version 5 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again