Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 173 (02 Dec 2020)
Sequence version 5 (12 Sep 2018)
Previous versions | rss
Add a publicationFeedback
Protein

Zonadhesin

Gene

ZAN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds in a species-specific manner to the zona pellucida of the egg. May be involved in gamete recognition and/or signaling.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9Y493

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zonadhesin
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZAN
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...
EuPathDBi
HostDB:ENSG00000146839.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:12857, ZAN

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602372, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y493

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini18 – 2757ExtracellularSequence analysisAdd BLAST2740
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei2758 – 2778HelicalSequence analysisAdd BLAST21
Topological domaini2779 – 2812CytoplasmicSequence analysisAdd BLAST34

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
7455

Open Targets

More...
OpenTargetsi
ENSG00000146839

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37446

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9Y493, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZAN

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 17Sequence analysisAdd BLAST17
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000778318 – 2812ZonadhesinAdd BLAST2795

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi333N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi493N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1112N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1188N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1685N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1804N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1900N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1946N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi2203N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi2542N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi2701N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi2712 ↔ 2723By similarity
Disulfide bondi2717 ↔ 2732By similarity
Disulfide bondi2734 ↔ 2743By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9Y493

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9Y493

PeptideAtlas

More...
PeptideAtlasi
Q9Y493

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y493

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
86132 [Q9Y493-1]
86133 [Q9Y493-2]
86134 [Q9Y493-3]
86135 [Q9Y493-4]
86136 [Q9Y493-5]
86137 [Q9Y493-6]
86138 [Q9Y493-7]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q9Y493, 11 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y493

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y493

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

In testis, primarily in haploid spermatids.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000146839, Expressed in right testis and 6 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9Y493, baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Probably forms covalent oligomers.

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
113294, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000480750

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9Y493, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Y493

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini39 – 204MAM 1PROSITE-ProRule annotationAdd BLAST166
Domaini209 – 368MAM 2PROSITE-ProRule annotationAdd BLAST160
Domaini371 – 536MAM 3PROSITE-ProRule annotationAdd BLAST166
Domaini1044 – 1093TIL 1Add BLAST50
Domaini1103 – 1148VWFC 1Add BLAST46
Domaini1155 – 1371VWFD 1PROSITE-ProRule annotationAdd BLAST217
Domaini1426 – 1479TIL 2Add BLAST54
Domaini1480 – 1535VWFC 2Add BLAST56
Domaini1541 – 1758VWFD 2PROSITE-ProRule annotationAdd BLAST218
Domaini1812 – 1867TIL 3Add BLAST56
Domaini1868 – 1924VWFC 3Add BLAST57
Domaini1930 – 2144VWFD 3PROSITE-ProRule annotationAdd BLAST215
Domaini2211 – 2267TIL 4Add BLAST57
Domaini2268 – 2329VWFC 4Add BLAST62
Domaini2330 – 2537VWFD 4PROSITE-ProRule annotationAdd BLAST208
Domaini2652 – 2797VWFC 5Add BLAST146
Domaini2708 – 2744EGF-likePROSITE-ProRule annotationAdd BLAST37

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni573 – 104166 X heptapeptide repeats (approximate) (mucin-like domain)Add BLAST469

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The MAM domains probably mediate sperm adhesion to the zona pellucida.
During sperm migration through the reproductive tracts, the mucin-like domain might inhibit inappropriate trapping of spermatozoa or promoting adhesion to the oviductal isthmus.
The VWFD domain 2 may mediate covalent oligomerization.By similarity

Keywords - Domaini

EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1216, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156850

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y493

Identification of Orthologs from Complete Genome Data

More...
OMAi
NTVYQSC

Database of Orthologous Groups

More...
OrthoDBi
22053at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y493

Family and domain databases

Conserved Domains Database

More...
CDDi
cd06263, MAM, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013320, ConA-like_dom_sf
IPR000742, EGF-like_dom
IPR000998, MAM_dom
IPR036084, Ser_inhib-like_sf
IPR002919, TIL_dom
IPR025615, TILa_dom
IPR014853, Unchr_dom_Cys-rich
IPR001007, VWF_dom
IPR001846, VWF_type-D

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08742, C8, 4 hits
PF00629, MAM, 3 hits
PF01826, TIL, 4 hits
PF12714, TILa, 5 hits
PF00094, VWD, 4 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00832, C8, 4 hits
SM00181, EGF, 4 hits
SM00137, MAM, 3 hits
SM00214, VWC, 4 hits
SM00215, VWC_out, 4 hits
SM00216, VWD, 4 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49899, SSF49899, 3 hits
SSF57567, SSF57567, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00022, EGF_1, 1 hit
PS01186, EGF_2, 4 hits
PS50026, EGF_3, 1 hit
PS00740, MAM_1, 1 hit
PS50060, MAM_2, 3 hits
PS51233, VWFD, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 3 (identifier: Q9Y493-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVPPVWTLLL LVGAALFRKE KPPDQKLVVR SSRDNYVLTQ CDFEDDAKPL
60 70 80 90 100
CDWSQVSADD EDWVRASGPS PTGSTGAPGG YPNGEGSYLH MESNSFHRGG
110 120 130 140 150
VARLLSPDLW EQGPLCVHFA HHMFGLSWGA QLRLLLLSGE EGRRPDVLWK
160 170 180 190 200
HWNTQRPSWM LTTVTVPAGF TLPTRLMFEG TRGSTAYLDI ALDALSIRRG
210 220 230 240 250
SCNRVCMMQT CSFDIPNDLC DWTWIPTASG AKWTQKKGSS GKPGVGPDGD
260 270 280 290 300
FSSPGSGCYM LLDPKNARPG QKAVLLSPVS LSSGCLSFSF HYILRGQSPG
310 320 330 340 350
AALHIYASVL GSIRKHTLFS GQPGPNWQAV SVNYTAVGRI QFAVVGVFGK
360 370 380 390 400
TPEPAVAVDA TSIAPCGEGF PQCDFEDNAH PFCDWVQTSG DGGHWALGHK
410 420 430 440 450
NGPVHGMGPA GGFPNAGGHY IYLEADEFSQ AGQSVRLVSR PFCAPGDICV
460 470 480 490 500
EFAYHMYGLG EGTMLELLLG SPAGSPPIPL WKRVGSQRPY WQNTSVTVPS
510 520 530 540 550
GHQQPMQLIF KGIQGSNTAS VVAMGFILIN PGTCPVKVLP ELPPVSPVSS
560 570 580 590 600
TGPSETTGLT ENPTISTKKP TVSIEKPSVT TEKPTVPKEK PTIPTEKPTI
610 620 630 640 650
STEKPTIPSE KPNMPSEKPT IPSEKPTILT EKPTIPSEKP TIPSEKPTIS
660 670 680 690 700
TEKPTVPTEE PTTPTEETTT SMEEPVIPTE KPSIPTEKPS IPTEKPTISM
710 720 730 740 750
EETIISTEKP TISPEKPTIP TEKPTIPTEK STISPEKPTT PTEKPTIPTE
760 770 780 790 800
KPTISPEKPT TPTEKPTISP EKLTIPTEKP TIPTEKPTIP TEKPTISTEE
810 820 830 840 850
PTTPTEETTI STEKPSIPME KPTLPTEETT TSVEETTIST EKLTIPMEKP
860 870 880 890 900
TISTEKPTIP TEKPTISPEK LTIPTEKLTI PTEKPTIPIE ETTISTEKLT
910 920 930 940 950
IPTEKPTISP EKPTISTEKP TIPTEKPTIP TEETTISTEK LTIPTEKPTI
960 970 980 990 1000
SPEKLTIPTE KPTISTEKPT IPTEKLTIPT EKPTIPTEKP TIPTEKLTAL
1010 1020 1030 1040 1050
RPPHPSPTAT GLAALVMSPH APSTPMTSVI LGTTTTSRSS TERCPPNARY
1060 1070 1080 1090 1100
ESCACPASCK SPRPSCGPLC REGCVCNPGF LFSDNHCIQA SSCNCFYNND
1110 1120 1130 1140 1150
YYEPGAEWFS PNCTEHCRCW PGSRVECQIS QCGTHTVCQL KNGQYGCHPY
1160 1170 1180 1190 1200
AGTATCLVYG DPHYVTFDGR HFGFMGKCTY ILAQPCGNST DPFFRVTAKN
1210 1220 1230 1240 1250
EEQGQEGVSC LSKVYVTLPE STVTLLKGRR TLVGGQQVTL PAIPSKGVFL
1260 1270 1280 1290 1300
GASGRFVELQ TEFGLRVRWD GDQQLYVTVS STYSGKLCGL CGNYDGNSDN
1310 1320 1330 1340 1350
DHLKLDGSPA GDKEELGNSW QTDQDEDQEC QKYQVVNSPS CDSSLQSSMS
1360 1370 1380 1390 1400
GPGFCGRLVD THGPFETCLL HVKAASFFDS CMLDMCGFQG LQHLLCTHMS
1410 1420 1430 1440 1450
TMTTTCQDAG HAVKPWREPH FCPMACPPNS KYSLCAKPCP DTCHSGFSGM
1460 1470 1480 1490 1500
FCSDRCVEAC ECNPGFVLSG LECIPRSQCG CLHPAGSYFK VGERWYKPGC
1510 1520 1530 1540 1550
KELCVCESNN RIRCQPWRCR AQEFCGQQDG IYGCHAQGAA TCTASGDPHY
1560 1570 1580 1590 1600
LTFDGALHHF MGTCTYVLTR PCWSRSQDSY FVVSATNENR GGILEVSYIK
1610 1620 1630 1640 1650
AVHVTVFDLS ISLLRGCKVM LNGHRVALPV WLAQGRVTIR LSSNLVLLYT
1660 1670 1680 1690 1700
NFGLQVRYDG SHLVEVTVPS SYGGQLCGLC GNYNNNSLDD NLRPDRKLAG
1710 1720 1730 1740 1750
DSMQLGAAWK LPESSEPGCF LVGGKPSSCQ ENSMADAWNK NCAILINPQG
1760 1770 1780 1790 1800
PFSQCHQVVP PQSSFASCVH GQCGTKGDTT ALCRSLQAYA SLCAQAGQAP
1810 1820 1830 1840 1850
AWRNRTFCPM RCPPGSSYSP CSSPCPDTCS SINNPRDCPK ALPCAESCEC
1860 1870 1880 1890 1900
QKGHILSGTS CVPLGQCGCT DPAGSYHPVG ERWYTENTCT RLCTCSVHNN
1910 1920 1930 1940 1950
ITCFQSTCKP NQICWALDGL LHCRASGVGV CQLPGESHYV SFDGSNHSIP
1960 1970 1980 1990 2000
DACTLVLVKV CHPAMALPFF KISAKHEKEE GGTEAFRLHE VYIDIYDAQV
2010 2020 2030 2040 2050
TLQKGHRVLI NSKQVTLPAI SQIPGVSVKS SSIYSIVNIK IGVQVKFDGN
2060 2070 2080 2090 2100
HLLEIEIPTT YYGKVCGMCG NFNDEEEDEL MMPSDEVANS DSEFVNSWKD
2110 2120 2130 2140 2150
KDIDPSCQSL LVDEQQIPAE QQENPSGNCR AADLRRAREK CEAALRAPVW
2160 2170 2180 2190 2200
AQCASRIDLT PFLVDCANTL CEFGGLYQAL CQALQAFGAT CQSQGLKPPL
2210 2220 2230 2240 2250
WRNSSFCPLE CPAYSSYTNC LPSCSPSCWD LDGRCEGAKV PSACAEGCIC
2260 2270 2280 2290 2300
QPGYVLSEDK CVPRSQCGCK DAHGGSIPLG KSWVSSGCTE KCVCTGGAIQ
2310 2320 2330 2340 2350
CGDFRCPSGS HCQLTSDNSN SNCVSDKSEQ CSVYGDPRYL TFDGFSYRLQ
2360 2370 2380 2390 2400
GRMTYVLIKT VDVLPEGVEP LLVEGRNKMD PPRSSIFLQE VITTVYGYKV
2410 2420 2430 2440 2450
QLQAGLELVV NNQKMAVPYR PNEHLRVTLW GQRLYLVTDF ELVVSFGGRK
2460 2470 2480 2490 2500
NAVISLPSMY EGLVSGLCGN YDKNRKNDMM LPSGALTQNL NTFGNSWEVK
2510 2520 2530 2540 2550
TEDALLRFPR AIPAEEEGQG AELGLRTGLQ VSECSPEQLA SNSTQACRVL
2560 2570 2580 2590 2600
ADPQGPFAAC HQTVAPEPFQ EHCVLDLCSA QDPREQEELR CQVLSGHGVS
2610 2620 2630 2640 2650
SRYHISELYD TLPSILCQPG RPRGLRGPLR GRLRQHPRLC LQWHPEPPLA
2660 2670 2680 2690 2700
DCGCTSNGIY YQLGSSFLTE DCSQRCTCAS SRILLCEPFS CRAGEVCTLG
2710 2720 2730 2740 2750
NHTQGCFPES PCLQNPCQND GQCREQGATF TCECEVGYGG GLCMEPRDAP
2760 2770 2780 2790 2800
PPRKPASNLV GVLLGLLVPV VVVLLAVTRE CIYRTRRKRE KTQEGDRLAR
2810
LVDTDTVLDC AC
Length:2,812
Mass (Da):305,630
Last modified:September 12, 2018 - v5
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i905BF4706FCC10F2
GO
Isoform 1 (identifier: Q9Y493-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2724: HGVSSRYHIS...NPCQNDGQCR → YAILCQEAGA...PFLAGQQLSD
     2725-2812: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:2,724
Mass (Da):295,242
Checksum:i77AC4CD70EE89104
GO
Isoform 2 (identifier: Q9Y493-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2689: HGVSSRYHIS...SSRILLCEPF → YAILCQEAGA...ASTTSWAAAF
     2690-2812: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:2,689
Mass (Da):291,337
Checksum:i53118D579CD4928D
GO
Isoform 4 (identifier: Q9Y493-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2624: HGVSSRYHISELYDTLPSILCQPGRPRG → YAILCQEAGAALAGWRDRTLCAGQQLSD
     2625-2812: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:2,624
Mass (Da):284,829
Checksum:i6E3A43FDDB7FC5C1
GO
Isoform 5 (identifier: Q9Y493-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2601: HGVSS → WAAAF
     2602-2812: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:2,601
Mass (Da):282,412
Checksum:i4865A15B3B6448CD
GO
Isoform 6 (identifier: Q9Y493-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2617: HGVSSRYHISELYDTLPSILC → YAILCQEAGAALAGWRDRTLC
     2618-2708: Missing.

Show »
Length:2,721
Mass (Da):295,475
Checksum:iBA85AB099E99BD76
GO
Isoform 7 (identifier: Q9Y493-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2636: HGVSSRYHIS...GPLRGRLRQH → YAILCQEAGA...EGPCVEGCAD
     2663-2666: LGSS → VRAGSRRPWGAEAPRRARPGMELERLLLALPFLAGQQ

Show »
Length:2,866
Mass (Da):311,061
Checksum:i35E18A5CCF996A1F
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC78790 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence EAW76487 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence EAW76488 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence EAW76489 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence EAW76490 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence EAW76491 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence EAW76492 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1922H → R in AAK01431 (Ref. 1) 1
Sequence conflicti1922H → R in AAK01432 (Ref. 1) 1
Sequence conflicti1922H → R in AAK01433 (Ref. 1) 1
Sequence conflicti1922H → R in AAK01434 (Ref. 1) 1
Sequence conflicti1922H → R in AAK01435 (Ref. 1) 1
Sequence conflicti1922H → R in AAK01436 (Ref. 1) 1
Sequence conflicti1922H → R in EAW76487 (Ref. 4) 1
Sequence conflicti1922H → R in EAW76488 (Ref. 4) 1
Sequence conflicti1922H → R in EAW76489 (Ref. 4) 1
Sequence conflicti1922H → R in EAW76490 (Ref. 4) 1
Sequence conflicti1922H → R in EAW76491 (Ref. 4) 1
Sequence conflicti1922H → R in EAW76492 (Ref. 4) 1
Sequence conflicti2430W → R in AAL04410 (PubMed:17033959).Curated1
Sequence conflicti2430W → R in AAL04411 (PubMed:17033959).Curated1
Sequence conflicti2430W → R in AAL04412 (PubMed:17033959).Curated1
Sequence conflicti2430W → R in AAL04413 (PubMed:17033959).Curated1
Sequence conflicti2430W → R in AAL04414 (PubMed:17033959).Curated1
Sequence conflicti2430W → R in AAL04415 (PubMed:17033959).Curated1
Sequence conflicti2430W → R in ABJ98522 (PubMed:17033959).Curated1
Sequence conflicti2430W → R in AAK21011 (PubMed:11239002).Curated1
Sequence conflicti2430W → R in AAC51208 (PubMed:9126492).Curated1
Sequence conflicti2555G → A in AAC51208 (PubMed:9126492).Curated1
Sequence conflicti2565A → P in AAC51208 (PubMed:9126492).Curated1
Sequence conflicti2761G → A in AAK01433 (Ref. 1) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06458416L → F. Corresponds to variant dbSNP:rs12673246Ensembl.1
Natural variantiVAR_061162113G → A. Corresponds to variant dbSNP:rs34828430Ensembl.1
Natural variantiVAR_055785412G → S. Corresponds to variant dbSNP:rs17162408Ensembl.1
Natural variantiVAR_064585430Q → H2 PublicationsCorresponds to variant dbSNP:rs221833Ensembl.1
Natural variantiVAR_055786690S → T. Corresponds to variant dbSNP:rs13241461Ensembl.1
Natural variantiVAR_0557871012L → R. Corresponds to variant dbSNP:rs6942733Ensembl.1
Natural variantiVAR_0557881096F → C. Corresponds to variant dbSNP:rs221823Ensembl.1
Natural variantiVAR_0557891375A → T. Corresponds to variant dbSNP:rs2293767Ensembl.1
Natural variantiVAR_0557901674G → C. Corresponds to variant dbSNP:rs10953303Ensembl.1
Natural variantiVAR_0557911698L → P. Corresponds to variant dbSNP:rs10247980Ensembl.1
Natural variantiVAR_0557921742C → R. Corresponds to variant dbSNP:rs17147735Ensembl.1
Natural variantiVAR_0557931878P → S. Corresponds to variant dbSNP:rs314298Ensembl.1
Natural variantiVAR_0557941903C → Y. Corresponds to variant dbSNP:rs12673041Ensembl.1
Natural variantiVAR_0645861922H → C Requires 2 nucleotide substitutions. Corresponds to variant dbSNP:rs314299Ensembl.1
Natural variantiVAR_0645871969F → L3 PublicationsCorresponds to variant dbSNP:rs542137Ensembl.1
Natural variantiVAR_0592781995I → M1 PublicationCorresponds to variant dbSNP:rs541275Ensembl.1
Natural variantiVAR_0645882035S → T3 PublicationsCorresponds to variant dbSNP:rs539445Ensembl.1
Natural variantiVAR_0592792073N → S. Corresponds to variant dbSNP:rs314300Ensembl.1
Natural variantiVAR_0645892111L → P3 PublicationsCorresponds to variant dbSNP:rs531503Ensembl.1
Natural variantiVAR_0611632334Y → S. Corresponds to variant dbSNP:rs60783739Ensembl.1
Natural variantiVAR_0611642349L → F. Corresponds to variant dbSNP:rs59541653Ensembl.1
Natural variantiVAR_0592802527T → M. Corresponds to variant dbSNP:rs3847059Ensembl.1
Natural variantiVAR_0592812643W → R. Corresponds to variant dbSNP:rs314339Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0014302597 – 2724HGVSS…DGQCR → YAILCQEAGAALAGWRDRTL CAMECPAGTIYQSCMTPCPA SCANLADPGDCEGPCVEGCA SIPGYAYSGTQSLPWLTVAA PAMASTTRSELAAGGPGEQR RQGEPDQGWNWNVSSWPFPF LAGQQLSD in isoform 1. 1 PublicationAdd BLAST128
Alternative sequenceiVSP_0014282597 – 2689HGVSS…LCEPF → YAILCQEAGAALAGWRDRTL CAMECPAGTIYQSCMTPCPA SCANLADPGDCEGPCVEGCA SIPGYAYSGTQSLPWLTVAA PAMASTTSWAAAF in isoform 2. 1 PublicationAdd BLAST93
Alternative sequenceiVSP_0014262597 – 2636HGVSS…RLRQH → YAILCQEAGAALAGWRDRTL CAMECPAGTIYQSCMTPCPA SCANLADPGDCEGPCVEGCA D in isoform 7. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_0014242597 – 2624HGVSS…GRPRG → YAILCQEAGAALAGWRDRTL CAGQQLSD in isoform 4. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_0014222597 – 2617HGVSS…PSILC → YAILCQEAGAALAGWRDRTL C in isoform 6. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_0014202597 – 2601HGVSS → WAAAF in isoform 5. 1 Publication5
Alternative sequenceiVSP_0014212602 – 2812Missing in isoform 5. 1 PublicationAdd BLAST211
Alternative sequenceiVSP_0014232618 – 2708Missing in isoform 6. 1 PublicationAdd BLAST91
Alternative sequenceiVSP_0014252625 – 2812Missing in isoform 4. 1 PublicationAdd BLAST188
Alternative sequenceiVSP_0014272663 – 2666LGSS → VRAGSRRPWGAEAPRRARPG MELERLLLALPFLAGQQ in isoform 7. 1 Publication4
Alternative sequenceiVSP_0014292690 – 2812Missing in isoform 2. 1 PublicationAdd BLAST123
Alternative sequenceiVSP_0014312725 – 2812Missing in isoform 1. 1 PublicationAdd BLAST88

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF332975 mRNA Translation: AAK01431.1
AF332976 mRNA Translation: AAK01432.1
AF332977 mRNA Translation: AAK01433.1
AF332978 mRNA Translation: AAK01434.1
AF332979 mRNA Translation: AAK01435.1
AF332980 mRNA Translation: AAK01436.1
EF025894 Genomic DNA Translation: ABJ98522.1
AY046055 Genomic DNA Translation: AAL04410.1
AY046055 Genomic DNA Translation: AAL04411.1
AY046055 Genomic DNA Translation: AAL04412.1
AY046055 Genomic DNA Translation: AAL04413.1
AY046055 Genomic DNA Translation: AAL04414.1
AY046055 Genomic DNA Translation: AAL04415.1
AC009488 Genomic DNA No translation available.
AC011895 Genomic DNA No translation available.
KF570250 Genomic DNA No translation available.
CH471091 Genomic DNA Translation: EAW76487.1 Sequence problems.
CH471091 Genomic DNA Translation: EAW76488.1 Sequence problems.
CH471091 Genomic DNA Translation: EAW76489.1 Sequence problems.
CH471091 Genomic DNA Translation: EAW76490.1 Sequence problems.
CH471091 Genomic DNA Translation: EAW76491.1 Sequence problems.
CH471091 Genomic DNA Translation: EAW76492.1 Sequence problems.
AF053356 Genomic DNA Translation: AAC78790.1 Sequence problems.
AF312032 Genomic DNA Translation: AAK21011.1
U83191 mRNA Translation: AAC51208.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47663.2 [Q9Y493-6]
CCDS47664.2 [Q9Y493-1]

NCBI Reference Sequences

More...
RefSeqi
NP_003377.2, NM_003386.2 [Q9Y493-1]
NP_775082.2, NM_173059.2 [Q9Y493-6]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000538115; ENSP00000445091; ENSG00000146839 [Q9Y493-4]
ENST00000542585; ENSP00000444427; ENSG00000146839 [Q9Y493-3]
ENST00000546213; ENSP00000441117; ENSG00000146839 [Q9Y493-5]
ENST00000546292; ENSP00000445943; ENSG00000146839 [Q9Y493-6]
ENST00000613979; ENSP00000480750; ENSG00000146839 [Q9Y493-1]
ENST00000618565; ENSP00000478371; ENSG00000146839 [Q9Y493-1]
ENST00000620596; ENSP00000481742; ENSG00000146839 [Q9Y493-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
7455

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:7455

UCSC genome browser

More...
UCSCi
uc032zzh.1, human

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF332975 mRNA Translation: AAK01431.1
AF332976 mRNA Translation: AAK01432.1
AF332977 mRNA Translation: AAK01433.1
AF332978 mRNA Translation: AAK01434.1
AF332979 mRNA Translation: AAK01435.1
AF332980 mRNA Translation: AAK01436.1
EF025894 Genomic DNA Translation: ABJ98522.1
AY046055 Genomic DNA Translation: AAL04410.1
AY046055 Genomic DNA Translation: AAL04411.1
AY046055 Genomic DNA Translation: AAL04412.1
AY046055 Genomic DNA Translation: AAL04413.1
AY046055 Genomic DNA Translation: AAL04414.1
AY046055 Genomic DNA Translation: AAL04415.1
AC009488 Genomic DNA No translation available.
AC011895 Genomic DNA No translation available.
KF570250 Genomic DNA No translation available.
CH471091 Genomic DNA Translation: EAW76487.1 Sequence problems.
CH471091 Genomic DNA Translation: EAW76488.1 Sequence problems.
CH471091 Genomic DNA Translation: EAW76489.1 Sequence problems.
CH471091 Genomic DNA Translation: EAW76490.1 Sequence problems.
CH471091 Genomic DNA Translation: EAW76491.1 Sequence problems.
CH471091 Genomic DNA Translation: EAW76492.1 Sequence problems.
AF053356 Genomic DNA Translation: AAC78790.1 Sequence problems.
AF312032 Genomic DNA Translation: AAK21011.1
U83191 mRNA Translation: AAC51208.1
CCDSiCCDS47663.2 [Q9Y493-6]
CCDS47664.2 [Q9Y493-1]
RefSeqiNP_003377.2, NM_003386.2 [Q9Y493-1]
NP_775082.2, NM_173059.2 [Q9Y493-6]

3D structure databases

SMRiQ9Y493
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi113294, 1 interactor
STRINGi9606.ENSP00000480750

PTM databases

GlyGeniQ9Y493, 11 sites
iPTMnetiQ9Y493
PhosphoSitePlusiQ9Y493

Polymorphism and mutation databases

BioMutaiZAN

Proteomic databases

jPOSTiQ9Y493
MassIVEiQ9Y493
PeptideAtlasiQ9Y493
PRIDEiQ9Y493
ProteomicsDBi86132 [Q9Y493-1]
86133 [Q9Y493-2]
86134 [Q9Y493-3]
86135 [Q9Y493-4]
86136 [Q9Y493-5]
86137 [Q9Y493-6]
86138 [Q9Y493-7]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
73512, 44 antibodies

Genome annotation databases

EnsembliENST00000538115; ENSP00000445091; ENSG00000146839 [Q9Y493-4]
ENST00000542585; ENSP00000444427; ENSG00000146839 [Q9Y493-3]
ENST00000546213; ENSP00000441117; ENSG00000146839 [Q9Y493-5]
ENST00000546292; ENSP00000445943; ENSG00000146839 [Q9Y493-6]
ENST00000613979; ENSP00000480750; ENSG00000146839 [Q9Y493-1]
ENST00000618565; ENSP00000478371; ENSG00000146839 [Q9Y493-1]
ENST00000620596; ENSP00000481742; ENSG00000146839 [Q9Y493-6]
GeneIDi7455
KEGGihsa:7455
UCSCiuc032zzh.1, human

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7455
DisGeNETi7455
EuPathDBiHostDB:ENSG00000146839.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZAN
HGNCiHGNC:12857, ZAN
MIMi602372, gene
neXtProtiNX_Q9Y493
OpenTargetsiENSG00000146839
PharmGKBiPA37446

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1216, Eukaryota
GeneTreeiENSGT00940000156850
InParanoidiQ9Y493
OMAiNTVYQSC
OrthoDBi22053at2759
PhylomeDBiQ9Y493

Enzyme and pathway databases

PathwayCommonsiQ9Y493

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
7455, 2 hits in 68 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZAN, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
7455
PharosiQ9Y493, Tdark

Protein Ontology

More...
PROi
PR:Q9Y493
RNActiQ9Y493, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000146839, Expressed in right testis and 6 other tissues
ExpressionAtlasiQ9Y493, baseline and differential

Family and domain databases

CDDicd06263, MAM, 3 hits
InterProiView protein in InterPro
IPR013320, ConA-like_dom_sf
IPR000742, EGF-like_dom
IPR000998, MAM_dom
IPR036084, Ser_inhib-like_sf
IPR002919, TIL_dom
IPR025615, TILa_dom
IPR014853, Unchr_dom_Cys-rich
IPR001007, VWF_dom
IPR001846, VWF_type-D
PfamiView protein in Pfam
PF08742, C8, 4 hits
PF00629, MAM, 3 hits
PF01826, TIL, 4 hits
PF12714, TILa, 5 hits
PF00094, VWD, 4 hits
SMARTiView protein in SMART
SM00832, C8, 4 hits
SM00181, EGF, 4 hits
SM00137, MAM, 3 hits
SM00214, VWC, 4 hits
SM00215, VWC_out, 4 hits
SM00216, VWD, 4 hits
SUPFAMiSSF49899, SSF49899, 3 hits
SSF57567, SSF57567, 4 hits
PROSITEiView protein in PROSITE
PS00022, EGF_1, 1 hit
PS01186, EGF_2, 4 hits
PS50026, EGF_3, 1 hit
PS00740, MAM_1, 1 hit
PS50060, MAM_2, 3 hits
PS51233, VWFD, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZAN_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y493
Secondary accession number(s): A0A087WU49
, A0FKC8, D6W5W4, O00218, Q96L85, Q96L86, Q96L87, Q96L88, Q96L89, Q96L90, Q9BXN9, Q9BZ83, Q9BZ84, Q9BZ85, Q9BZ86, Q9BZ87, Q9BZ88
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: September 12, 2018
Last modified: December 2, 2020
This is version 173 of the entry and version 5 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again