Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 133 (02 Jun 2021)
Sequence version 2 (06 Feb 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Small kinetochore-associated protein

Gene

KNSTRN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Essential component of the mitotic spindle required for faithful chromosome segregation and progression into anaphase (PubMed:19667759).

Promotes the metaphase-to-anaphase transition and is required for chromosome alignment, normal timing of sister chromatid segregation, and maintenance of spindle pole architecture (PubMed:19667759, PubMed:22110139).

The astrin (SPAG5)-kinastrin (SKAP) complex promotes stable microtubule-kinetochore attachments (PubMed:21402792).

Required for kinetochore oscillations and dynamics of microtubule plus-ends during live cell mitosis, possibly by forming a link between spindle microtubule plus-ends and mitotic chromosomes to achieve faithful cell division (PubMed:23035123).

May be involved in UV-induced apoptosis via its interaction with PRPF19; however, these results need additional evidences (PubMed:24718257).

1 Publication4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, Cell division, Mitosis

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9Y448

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9Y448

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Small kinetochore-associated protein1 Publication
Short name:
SKAP1 Publication
Alternative name(s):
Kinetochore-localized astrin-binding protein1 Publication
Short name:
Kinastrin1 Publication
Kinetochore-localized astrin/SPAG5-binding protein
TRAF4-associated factor 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KNSTRNImported
Synonyms:C15orf23Imported, SKAP1 Publication, TRAF4AF1
ORF Names:HSD11
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30767, KNSTRN

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
614718, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y448

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000128944.13

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Cytoskeleton, Kinetochore, Microtubule, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Cutaneous squamous cell carcinomas (SCC): A malignancy of the skin. The hallmark of cutaneous SCC is malignant transformation of normal epidermal keratinocytes. Disease susceptibility is associated with variants affecting the gene represented in this entry. Variant Phe-24 appears specific for UV-associated malignancies (PubMed:25194279).1 Publication

Keywords - Diseasei

Disease variant

Organism-specific databases

DisGeNET

More...
DisGeNETi
90417

MalaCards human disease database

More...
MalaCardsi
KNSTRN

Open Targets

More...
OpenTargetsi
ENSG00000128944

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
221139, Combined immunodeficiency with faciooculoskeletal anomalies

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134895025

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9Y448, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
KNSTRN

Domain mapping of disease mutations (DMDM)

More...
DMDMi
125991199

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002745121 – 316Small kinetochore-associated proteinAdd BLAST316

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei128PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9Y448

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9Y448

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9Y448

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y448

PeptideAtlas

More...
PeptideAtlasi
Q9Y448

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y448

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
86099 [Q9Y448-1]
86100 [Q9Y448-2]
86101 [Q9Y448-3]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
2078, 1 N-Linked glycan (1 site)

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q9Y448, 1 site, 1 N-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y448

MetOSite database of methionine sulfoxide sites

More...
MetOSitei
Q9Y448

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y448

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed, including in skin.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Degraded at the end of mitosis. Down-regulated upon exposure to nitric oxide.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000128944, Expressed in testis and 196 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9Y448, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Y448, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000128944, Group enriched (blood, lymphoid tissue, testis, thyroid gland)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Part of an astrin (SPAG5)-kinastrin (SKAP) complex containing KNSTRN, SPAG5, PLK1, DYNLL1 and SGO2.

Interacts with SPAG5. Directly binds to microtubules, although at relatively low affinity.

Interacts with CENPE; this interaction greatly favors microtubule-binding.

Interacts with DSN1/MIS13; leading to localization to kinetochores.

Interacts with MAPRE1/EB1; leading to localization to the microtubule plus ends.

Interacts with PRPF19.

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
124714, 62 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9Y448

Database of interacting proteins

More...
DIPi
DIP-31247N

Protein interaction database and analysis system

More...
IntActi
Q9Y448, 47 interactors

Molecular INTeraction database

More...
MINTi
Q9Y448

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000249776

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9Y448, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Y448

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni159 – 316Interaction with SPAG51 PublicationAdd BLAST158

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili166 – 216Sequence analysisAdd BLAST51
Coiled coili248 – 316Sequence analysisAdd BLAST69

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The coiled coil regions mediate binding to kinetochores.1 Publication

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502S60X, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000010376

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y448

Database of Orthologous Groups

More...
OrthoDBi
1460326at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y448

TreeFam database of animal gene trees

More...
TreeFami
TF336302

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR033373, SKAP

The PANTHER Classification System

More...
PANTHERi
PTHR31940, PTHR31940, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y448-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAPEAPPLD RVFRTTWLST ECDSHPLPPS YRKFLFETQA ADLAGGTTVA
60 70 80 90 100
AGNLLNESEK DCGQDRRAPG VQPCRLVTMT SVVKTVYSLQ PPSALSGGQP
110 120 130 140 150
ADTQTRATSK SLLPVRSKEV DVSKQLHSGG PENDVTKITK LRRENGQMKA
160 170 180 190 200
TDTATRRNVR KGYKPLSKQK SEEELKDKNQ LLEAVNKQLH QKLTETQGEL
210 220 230 240 250
KDLTQKVELL EKFRDNCLAI LESKGLDPAL GSETLASRQE STTDHMDSML
260 270 280 290 300
LLETLQEELK LFNETAKKQM EELQALKVKL EMKEERVRFL EQQTLCNNQV
310
NDLTTALKEM EQLLEM
Length:316
Mass (Da):35,438
Last modified:February 6, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6FC6745DBA6B70D8
GO
Isoform 2 (identifier: Q9Y448-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     275-316: ALKVKLEMKEERVRFLEQQTLCNNQVNDLTTALKEMEQLLEM → IAWMNHGILHQM

Show »
Length:286
Mass (Da):31,880
Checksum:i8EE608F67306D3DC
GO
Isoform 3 (identifier: Q9Y448-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     229-316: ALGSETLASR...LKEMEQLLEM → VAVRNFARGAEAF

Show »
Length:241
Mass (Da):26,586
Checksum:iF55DD94EF9CD69FE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YM11H0YM11_HUMAN
Small kinetochore-associated protei...
KNSTRN
217Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GY01V9GY01_HUMAN
Chromosome 15 open reading frame 23...
KNSTRN C15orf23, hCG_38973
238Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YLA7H0YLA7_HUMAN
Small kinetochore-associated protei...
KNSTRN
128Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YKF8H0YKF8_HUMAN
Small kinetochore-associated protei...
KNSTRN
124Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YKD4H0YKD4_HUMAN
Small kinetochore-associated protei...
KNSTRN
64Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YNN6H0YNN6_HUMAN
Small kinetochore-associated protei...
KNSTRN
67Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YN50H0YN50_HUMAN
Small kinetochore-associated protei...
KNSTRN
27Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YLH8H0YLH8_HUMAN
Small kinetochore-associated protei...
KNSTRN
126Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH04543 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated
The sequence AAH14060 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated
The sequence AAI07803 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti47T → K in AAH45739 (PubMed:15489334).Curated1
Sequence conflicti232S → G in AAI18640 (PubMed:15489334).Curated1
Sequence conflicti236A → S in AAD24201 (Ref. 6) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_07185724S → F in SCC; impaired chromatid cohesion. 1 PublicationCorresponds to variant dbSNP:rs868438023EnsemblClinVar.1
Natural variantiVAR_03030440A → E1 PublicationCorresponds to variant dbSNP:rs7164132Ensembl.1
Natural variantiVAR_03030575R → L1 PublicationCorresponds to variant dbSNP:rs7169404Ensembl.1
Natural variantiVAR_03030692P → S1 PublicationCorresponds to variant dbSNP:rs7169262Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_041069229 – 316ALGSE…QLLEM → VAVRNFARGAEAF in isoform 3. 1 PublicationAdd BLAST88
Alternative sequenceiVSP_041070275 – 316ALKVK…QLLEM → IAWMNHGILHQM in isoform 2. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY652615 mRNA Translation: AAT66172.1
AK301887 mRNA Translation: BAG63319.1
AC013356 Genomic DNA No translation available.
BC004543 mRNA Translation: AAH04543.1 Different termination.
BC014060 mRNA Translation: AAH14060.1 Different termination.
BC045739 mRNA Translation: AAH45739.1
BC064344 mRNA Translation: AAH64344.1
BC107802 mRNA Translation: AAI07803.1 Different initiation.
BC118559 mRNA Translation: AAI18560.1
BC118639 mRNA Translation: AAI18640.1
CR602848 mRNA No translation available.
CR611451 mRNA No translation available.
U81002 mRNA Translation: AAD24201.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS42021.1 [Q9Y448-1]
CCDS45226.1 [Q9Y448-2]
CCDS45227.1 [Q9Y448-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001136233.1, NM_001142761.1 [Q9Y448-2]
NP_001136234.1, NM_001142762.1 [Q9Y448-3]
NP_150628.3, NM_033286.3 [Q9Y448-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000249776; ENSP00000249776; ENSG00000128944 [Q9Y448-1]
ENST00000416151; ENSP00000391233; ENSG00000128944 [Q9Y448-2]
ENST00000448395; ENSP00000393001; ENSG00000128944 [Q9Y448-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
90417

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:90417

UCSC genome browser

More...
UCSCi
uc001zll.4, human [Q9Y448-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY652615 mRNA Translation: AAT66172.1
AK301887 mRNA Translation: BAG63319.1
AC013356 Genomic DNA No translation available.
BC004543 mRNA Translation: AAH04543.1 Different termination.
BC014060 mRNA Translation: AAH14060.1 Different termination.
BC045739 mRNA Translation: AAH45739.1
BC064344 mRNA Translation: AAH64344.1
BC107802 mRNA Translation: AAI07803.1 Different initiation.
BC118559 mRNA Translation: AAI18560.1
BC118639 mRNA Translation: AAI18640.1
CR602848 mRNA No translation available.
CR611451 mRNA No translation available.
U81002 mRNA Translation: AAD24201.1
CCDSiCCDS42021.1 [Q9Y448-1]
CCDS45226.1 [Q9Y448-2]
CCDS45227.1 [Q9Y448-3]
RefSeqiNP_001136233.1, NM_001142761.1 [Q9Y448-2]
NP_001136234.1, NM_001142762.1 [Q9Y448-3]
NP_150628.3, NM_033286.3 [Q9Y448-1]

3D structure databases

SMRiQ9Y448
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi124714, 62 interactors
CORUMiQ9Y448
DIPiDIP-31247N
IntActiQ9Y448, 47 interactors
MINTiQ9Y448
STRINGi9606.ENSP00000249776

PTM databases

GlyConnecti2078, 1 N-Linked glycan (1 site)
GlyGeniQ9Y448, 1 site, 1 N-linked glycan (1 site)
iPTMnetiQ9Y448
MetOSiteiQ9Y448
PhosphoSitePlusiQ9Y448

Genetic variation databases

BioMutaiKNSTRN
DMDMi125991199

Proteomic databases

EPDiQ9Y448
jPOSTiQ9Y448
MassIVEiQ9Y448
PaxDbiQ9Y448
PeptideAtlasiQ9Y448
PRIDEiQ9Y448
ProteomicsDBi86099 [Q9Y448-1]
86100 [Q9Y448-2]
86101 [Q9Y448-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
52276, 51 antibodies

The DNASU plasmid repository

More...
DNASUi
90417

Genome annotation databases

EnsembliENST00000249776; ENSP00000249776; ENSG00000128944 [Q9Y448-1]
ENST00000416151; ENSP00000391233; ENSG00000128944 [Q9Y448-2]
ENST00000448395; ENSP00000393001; ENSG00000128944 [Q9Y448-3]
GeneIDi90417
KEGGihsa:90417
UCSCiuc001zll.4, human [Q9Y448-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
90417
DisGeNETi90417

GeneCards: human genes, protein and diseases

More...
GeneCardsi
KNSTRN
HGNCiHGNC:30767, KNSTRN
HPAiENSG00000128944, Group enriched (blood, lymphoid tissue, testis, thyroid gland)
MalaCardsiKNSTRN
MIMi614718, gene
neXtProtiNX_Q9Y448
OpenTargetsiENSG00000128944
Orphaneti221139, Combined immunodeficiency with faciooculoskeletal anomalies
PharmGKBiPA134895025
VEuPathDBiHostDB:ENSG00000128944.13

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502S60X, Eukaryota
GeneTreeiENSGT00390000010376
InParanoidiQ9Y448
OrthoDBi1460326at2759
PhylomeDBiQ9Y448
TreeFamiTF336302

Enzyme and pathway databases

PathwayCommonsiQ9Y448
SIGNORiQ9Y448

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
90417, 13 hits in 996 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
90417
PharosiQ9Y448, Tbio

Protein Ontology

More...
PROi
PR:Q9Y448
RNActiQ9Y448, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000128944, Expressed in testis and 196 other tissues
ExpressionAtlasiQ9Y448, baseline and differential
GenevisibleiQ9Y448, HS

Family and domain databases

InterProiView protein in InterPro
IPR033373, SKAP
PANTHERiPTHR31940, PTHR31940, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSKAP_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y448
Secondary accession number(s): B4DXA7
, Q147U5, Q32Q57, Q5ISJ0, Q6P2S5, Q6PJM0, Q86XB4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: February 6, 2007
Last modified: June 2, 2021
This is version 133 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again