Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM32A

Gene

FAM32A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Isoform 1, but not isoform 2 or isoform 3, may induce G2 arrest and apoptosis. May also increase cell sensitivity to apoptotic stimuli.1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processApoptosis, Cell cycle

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM32A
Alternative name(s):
Ovarian tumor-associated gene 12
Short name:
OTAG-12
Gene namesi
Name:FAM32A
Synonyms:OTAG12
ORF Names:CGI-144
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000105058.11
HGNCiHGNC:24563 FAM32A
MIMi614554 gene
neXtProtiNX_Q9Y421

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi26017
OpenTargetsiENSG00000105058
PharmGKBiPA134956082

Polymorphism and mutation databases

BioMutaiFAM32A
DMDMi74753494

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002232501 – 112Protein FAM32AAdd BLAST112

Proteomic databases

EPDiQ9Y421
PaxDbiQ9Y421
PeptideAtlasiQ9Y421
PRIDEiQ9Y421
ProteomicsDBi86090
86091 [Q9Y421-2]
86092 [Q9Y421-3]
TopDownProteomicsiQ9Y421-1 [Q9Y421-1]

PTM databases

iPTMnetiQ9Y421
PhosphoSitePlusiQ9Y421

Expressioni

Tissue specificityi

Expressed in ovary, with isoform 1 being predominant.1 Publication

Inductioni

By etoposide, puromycin or carboplatin.1 Publication

Gene expression databases

BgeeiENSG00000105058 Expressed in 232 organ(s), highest expression level in frontal cortex
CleanExiHS_FAM32A
ExpressionAtlasiQ9Y421 baseline and differential
GenevisibleiQ9Y421 HS

Organism-specific databases

HPAiHPA051712

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
CWC22Q9HCG82EBI-726146,EBI-373289

Protein-protein interaction databases

BioGridi117488, 13 interactors
IntActiQ9Y421, 4 interactors
MINTiQ9Y421
STRINGi9606.ENSP00000263384

Structurei

3D structure databases

ProteinModelPortaliQ9Y421
SMRiQ9Y421
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi9 – 86Lys-richAdd BLAST78

Sequence similaritiesi

Belongs to the FAM32 family.Curated

Phylogenomic databases

eggNOGiKOG3410 Eukaryota
ENOG41126B2 LUCA
GeneTreeiENSGT00390000013811
HOGENOMiHOG000205758
HOVERGENiHBG081504
InParanoidiQ9Y421
KOiK13120
OMAiLSEHNDM
OrthoDBiEOG091G1285
PhylomeDBiQ9Y421
TreeFamiTF314020

Family and domain databases

InterProiView protein in InterPro
IPR013865 DUF1754_euk
PANTHERiPTHR13282 PTHR13282, 1 hit
PfamiView protein in Pfam
PF08555 DUF1754, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y421-1) [UniParc]FASTAAdd to basket
Also known as: OTAG-12b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEAYEQVQKG PLKLKGVAEL GVTKRKKKKK DKDKAKLLEA MGTSKKNEEE
60 70 80 90 100
KRRGLDKRTP AQAAFEKMQE KRQMERILKK ASKTHKQRVE DFNRHLDTLT
110
EHYDIPKVSW TK
Length:112
Mass (Da):13,178
Last modified:May 1, 2000 - v2
Checksum:i7FAF15315E9D580C
GO
Isoform 2 (identifier: Q9Y421-2) [UniParc]FASTAAdd to basket
Also known as: OTAG-12a

The sequence of this isoform differs from the canonical sequence as follows:
     74-112: MERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK → GHQTSCIATGFQGHKANAARSYAWIQNWYCVPSS

Show »
Length:107
Mass (Da):12,139
Checksum:iB8782C7C98B2953D
GO
Isoform 3 (identifier: Q9Y421-3) [UniParc]FASTAAdd to basket
Also known as: OTAG-12c

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MEAYEQVQKGPLKLKGVAELGVTK → MSFS

Show »
Length:92
Mass (Da):11,032
Checksum:i45051BB82E2515F8
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7ENN5K7ENN5_HUMAN
Protein FAM32A
FAM32A
107Annotation score:
K7EIY1K7EIY1_HUMAN
Protein FAM32A
FAM32A
94Annotation score:
K7ELZ8K7ELZ8_HUMAN
Protein FAM32A
FAM32A
82Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0438601 – 24MEAYE…LGVTK → MSFS in isoform 3. CuratedAdd BLAST24
Alternative sequenceiVSP_04386174 – 112MERIL…VSWTK → GHQTSCIATGFQGHKANAAR SYAWIQNWYCVPSS in isoform 2. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF151902 mRNA Translation: AAD34139.1
AL050157 mRNA Translation: CAB43298.2
BC000639 mRNA Translation: AAH00639.1
BC004447 mRNA Translation: AAH04447.1
BC017286 mRNA Translation: AAH17286.1
BU543240 mRNA No translation available.
CCDSiCCDS12341.1 [Q9Y421-1]
PIRiT08783
RefSeqiNP_054796.1, NM_014077.3 [Q9Y421-1]
UniGeneiHs.631614

Genome annotation databases

EnsembliENST00000263384; ENSP00000263384; ENSG00000105058 [Q9Y421-1]
ENST00000589852; ENSP00000465969; ENSG00000105058 [Q9Y421-3]
GeneIDi26017
KEGGihsa:26017
UCSCiuc002ndt.4 human [Q9Y421-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF151902 mRNA Translation: AAD34139.1
AL050157 mRNA Translation: CAB43298.2
BC000639 mRNA Translation: AAH00639.1
BC004447 mRNA Translation: AAH04447.1
BC017286 mRNA Translation: AAH17286.1
BU543240 mRNA No translation available.
CCDSiCCDS12341.1 [Q9Y421-1]
PIRiT08783
RefSeqiNP_054796.1, NM_014077.3 [Q9Y421-1]
UniGeneiHs.631614

3D structure databases

ProteinModelPortaliQ9Y421
SMRiQ9Y421
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117488, 13 interactors
IntActiQ9Y421, 4 interactors
MINTiQ9Y421
STRINGi9606.ENSP00000263384

PTM databases

iPTMnetiQ9Y421
PhosphoSitePlusiQ9Y421

Polymorphism and mutation databases

BioMutaiFAM32A
DMDMi74753494

Proteomic databases

EPDiQ9Y421
PaxDbiQ9Y421
PeptideAtlasiQ9Y421
PRIDEiQ9Y421
ProteomicsDBi86090
86091 [Q9Y421-2]
86092 [Q9Y421-3]
TopDownProteomicsiQ9Y421-1 [Q9Y421-1]

Protocols and materials databases

DNASUi26017
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263384; ENSP00000263384; ENSG00000105058 [Q9Y421-1]
ENST00000589852; ENSP00000465969; ENSG00000105058 [Q9Y421-3]
GeneIDi26017
KEGGihsa:26017
UCSCiuc002ndt.4 human [Q9Y421-1]

Organism-specific databases

CTDi26017
DisGeNETi26017
EuPathDBiHostDB:ENSG00000105058.11
GeneCardsiFAM32A
H-InvDBiHIX0014865
HGNCiHGNC:24563 FAM32A
HPAiHPA051712
MIMi614554 gene
neXtProtiNX_Q9Y421
OpenTargetsiENSG00000105058
PharmGKBiPA134956082
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3410 Eukaryota
ENOG41126B2 LUCA
GeneTreeiENSGT00390000013811
HOGENOMiHOG000205758
HOVERGENiHBG081504
InParanoidiQ9Y421
KOiK13120
OMAiLSEHNDM
OrthoDBiEOG091G1285
PhylomeDBiQ9Y421
TreeFamiTF314020

Miscellaneous databases

ChiTaRSiFAM32A human
GeneWikiiFAM32A
GenomeRNAii26017
PROiPR:Q9Y421
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000105058 Expressed in 232 organ(s), highest expression level in frontal cortex
CleanExiHS_FAM32A
ExpressionAtlasiQ9Y421 baseline and differential
GenevisibleiQ9Y421 HS

Family and domain databases

InterProiView protein in InterPro
IPR013865 DUF1754_euk
PANTHERiPTHR13282 PTHR13282, 1 hit
PfamiView protein in Pfam
PF08555 DUF1754, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiFA32A_HUMAN
AccessioniPrimary (citable) accession number: Q9Y421
Secondary accession number(s): Q9BT02
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 7, 2006
Last sequence update: May 1, 2000
Last modified: November 7, 2018
This is version 132 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again