Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9Y421 (FA32A_HUMAN)

Entry version 145 (02 Dec 2020)
Sequence version 2 (01 May 2000)
Previous versions | rss
Add a publicationFeedback
Protein

Protein FAM32A

Gene

FAM32A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Isoform 1, but not isoform 2 or isoform 3, may induce G2 arrest and apoptosis. May also increase cell sensitivity to apoptotic stimuli.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis, Cell cycle

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9Y421

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein FAM32A
Alternative name(s):
Ovarian tumor-associated gene 12
Short name:
OTAG-12
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FAM32A
Synonyms:OTAG12
ORF Names:CGI-144
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000105058.11

Human Gene Nomenclature Database

More...HGNCi		HGNC:24563, FAM32A

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		614554, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9Y421

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		26017

Open Targets

More...OpenTargetsi		ENSG00000105058

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134956082

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9Y421, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		FAM32A

Domain mapping of disease mutations (DMDM)

More...DMDMi		74753494

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002232501 – 112Protein FAM32AAdd BLAST112

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9Y421

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9Y421

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9Y421

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9Y421

PeptideAtlas

More...PeptideAtlasi		Q9Y421

PRoteomics IDEntifications database

More...PRIDEi		Q9Y421

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		86090 [Q9Y421-1]
86091 [Q9Y421-2]
86092 [Q9Y421-3]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		Q9Y421-1 [Q9Y421-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9Y421

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9Y421

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in ovary, with isoform 1 being predominant.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By etoposide, puromycin or carboplatin.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000105058, Expressed in cortical plate and 245 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9Y421, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9Y421, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000105058, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		117488, 16 interactors

Protein interaction database and analysis system

More...IntActi		Q9Y421, 5 interactors

Molecular INTeraction database

More...MINTi		Q9Y421

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000263384

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9Y421, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9Y421

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi9 – 86Lys-richAdd BLAST78

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the FAM32 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3410, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000013811

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_098435_3_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9Y421

Identification of Orthologs from Complete Genome Data

More...OMAi		HRMEQVV

Database of Orthologous Groups

More...OrthoDBi		1603617at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9Y421

TreeFam database of animal gene trees

More...TreeFami		TF314020

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR013865, FAM32A

The PANTHER Classification System

More...PANTHERi		PTHR13282, PTHR13282, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF08555, DUF1754, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y421-1) [UniParc]FASTAAdd to basket
Also known as: OTAG-12b

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEAYEQVQKG PLKLKGVAEL GVTKRKKKKK DKDKAKLLEA MGTSKKNEEE 
        60         70         80         90        100
KRRGLDKRTP AQAAFEKMQE KRQMERILKK ASKTHKQRVE DFNRHLDTLT 
       110 
EHYDIPKVSW TK
Length:112
Mass (Da):13,178
Last modified:May 1, 2000 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7FAF15315E9D580C
GO
Isoform 2 (identifier: Q9Y421-2) [UniParc]FASTAAdd to basket
Also known as: OTAG-12a

The sequence of this isoform differs from the canonical sequence as follows:
     74-112: MERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK → GHQTSCIATGFQGHKANAARSYAWIQNWYCVPSS

Show »
Length:107
Mass (Da):12,139
Checksum:iB8782C7C98B2953D
GO
Isoform 3 (identifier: Q9Y421-3) [UniParc]FASTAAdd to basket
Also known as: OTAG-12c

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MEAYEQVQKGPLKLKGVAELGVTK → MSFS

Show »
Length:92
Mass (Da):11,032
Checksum:i45051BB82E2515F8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7ELZ8K7ELZ8_HUMAN
Protein FAM32A
FAM32A
82Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EIY1K7EIY1_HUMAN
Protein FAM32A
FAM32A
94Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ENN5K7ENN5_HUMAN
Protein FAM32A
FAM32A
107Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0438601 – 24MEAYE…LGVTK → MSFS in isoform 3. CuratedAdd BLAST24
Alternative sequenceiVSP_04386174 – 112MERIL…VSWTK → GHQTSCIATGFQGHKANAAR SYAWIQNWYCVPSS in isoform 2. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF151902 mRNA Translation: AAD34139.1
AL050157 mRNA Translation: CAB43298.2
BC000639 mRNA Translation: AAH00639.1
BC004447 mRNA Translation: AAH04447.1
BC017286 mRNA Translation: AAH17286.1
BU543240 mRNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS12341.1 [Q9Y421-1]

Protein sequence database of the Protein Information Resource

More...PIRi		T08783

NCBI Reference Sequences

More...RefSeqi		NP_054796.1, NM_014077.3 [Q9Y421-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000263384; ENSP00000263384; ENSG00000105058 [Q9Y421-1]
ENST00000589852; ENSP00000465969; ENSG00000105058 [Q9Y421-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		26017

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:26017

UCSC genome browser

More...UCSCi		uc002ndt.4, human [Q9Y421-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF151902 mRNA Translation: AAD34139.1
AL050157 mRNA Translation: CAB43298.2
BC000639 mRNA Translation: AAH00639.1
BC004447 mRNA Translation: AAH04447.1
BC017286 mRNA Translation: AAH17286.1
BU543240 mRNA No translation available.
CCDSiCCDS12341.1 [Q9Y421-1]
PIRiT08783
RefSeqiNP_054796.1, NM_014077.3 [Q9Y421-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6QDVelectron microscopy3.30G53-112[»]
SMRiQ9Y421
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi117488, 16 interactors
IntActiQ9Y421, 5 interactors
MINTiQ9Y421
STRINGi9606.ENSP00000263384

PTM databases

iPTMnetiQ9Y421
PhosphoSitePlusiQ9Y421

Polymorphism and mutation databases

BioMutaiFAM32A
DMDMi74753494

Proteomic databases

EPDiQ9Y421
jPOSTiQ9Y421
MassIVEiQ9Y421
PaxDbiQ9Y421
PeptideAtlasiQ9Y421
PRIDEiQ9Y421
ProteomicsDBi86090 [Q9Y421-1]
86091 [Q9Y421-2]
86092 [Q9Y421-3]
TopDownProteomicsiQ9Y421-1 [Q9Y421-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		54347, 46 antibodies

The DNASU plasmid repository

More...DNASUi		26017

Genome annotation databases

EnsembliENST00000263384; ENSP00000263384; ENSG00000105058 [Q9Y421-1]
ENST00000589852; ENSP00000465969; ENSG00000105058 [Q9Y421-3]
GeneIDi26017
KEGGihsa:26017
UCSCiuc002ndt.4, human [Q9Y421-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		26017
DisGeNETi26017
EuPathDBiHostDB:ENSG00000105058.11

GeneCards: human genes, protein and diseases

More...GeneCardsi		FAM32A
HGNCiHGNC:24563, FAM32A
HPAiENSG00000105058, Low tissue specificity
MIMi614554, gene
neXtProtiNX_Q9Y421
OpenTargetsiENSG00000105058
PharmGKBiPA134956082

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3410, Eukaryota
GeneTreeiENSGT00390000013811
HOGENOMiCLU_098435_3_0_1
InParanoidiQ9Y421
OMAiHRMEQVV
OrthoDBi1603617at2759
PhylomeDBiQ9Y421
TreeFamiTF314020

Enzyme and pathway databases

PathwayCommonsiQ9Y421

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		26017, 563 hits in 851 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		FAM32A, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		FAM32A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		26017
PharosiQ9Y421, Tdark

Protein Ontology

More...PROi		PR:Q9Y421
RNActiQ9Y421, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000105058, Expressed in cortical plate and 245 other tissues
ExpressionAtlasiQ9Y421, baseline and differential
GenevisibleiQ9Y421, HS

Family and domain databases

InterProiView protein in InterPro
IPR013865, FAM32A
PANTHERiPTHR13282, PTHR13282, 1 hit
PfamiView protein in Pfam
PF08555, DUF1754, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFA32A_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y421
Secondary accession number(s): Q9BT02
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 7, 2006
Last sequence update: May 1, 2000
Last modified: December 2, 2020
This is version 145 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again