Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transmembrane emp24 domain-containing protein 3

Gene

TMED3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Potential role in vesicular protein trafficking, mainly in the early secretory pathway. Contributes to the coupled localization of TMED2 and TMED10 in the cis-Golgi network.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processProtein transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6807878 COPI-mediated anterograde transport
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic

Protein family/group databases

Transport Classification Database

More...
TCDBi
9.B.188.1.3 the transmembrane emp24 domain-containing protein (tmed) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transmembrane emp24 domain-containing protein 3
Alternative name(s):
Membrane protein p24B
p24 family protein gamma-4
Short name:
p24gamma4
p26
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TMED3
Synonyms:C15orf22
ORF Names:UNQ5357/PRO1078
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000166557.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:28889 TMED3

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y3Q3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini24 – 180LumenalSequence analysisAdd BLAST157
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei181 – 201HelicalSequence analysisAdd BLAST21
Topological domaini202 – 217CytoplasmicSequence analysisAdd BLAST16

Keywords - Cellular componenti

Cytoplasmic vesicle, Endoplasmic reticulum, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
23423

Open Targets

More...
OpenTargetsi
ENSG00000166557

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134958958

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TMED3

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 23Sequence analysisAdd BLAST23
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001038424 – 217Transmembrane emp24 domain-containing protein 3Add BLAST194

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9Y3Q3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y3Q3

PeptideAtlas

More...
PeptideAtlasi
Q9Y3Q3

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y3Q3

ProteomicsDB human proteome resource

More...
ProteomicsDBi
86059

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y3Q3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y3Q3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000166557 Expressed in 221 organ(s), highest expression level in parotid gland

CleanEx database of gene expression profiles

More...
CleanExi
HS_TMED3

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9Y3Q3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Y3Q3 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA049314
HPA076949

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer in endoplasmic reticulum, endoplasmic reticulum-Golgi intermediate compartment and cis-Golgi network. Interacts (via C-terminus) with COPG1; the interaction involves dimeric TMED3; however, there are conflicting reports on the interaction. Interacts with GORASP1 and GORASP2 (By similarity).By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116993, 18 interactors

Protein interaction database and analysis system

More...
IntActi
Q9Y3Q3, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000299705

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9Y3Q3

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Y3Q3

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini38 – 120GOLDPROSITE-ProRule annotationAdd BLAST83

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi204 – 217COPI vesicle coat-bindingSequence analysisAdd BLAST14
Motifi204 – 205COPII vesicle coat-bindingSequence analysis2

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the EMP24/GP25L family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1693 Eukaryota
ENOG4111JPD LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159833

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000160229

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG000271

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y3Q3

KEGG Orthology (KO)

More...
KOi
K20350

Identification of Orthologs from Complete Genome Data

More...
OMAi
NYDVDCF

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0LX8

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y3Q3

TreeFam database of animal gene trees

More...
TreeFami
TF313000

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009038 GOLD_dom
IPR036598 GOLD_dom_sf
IPR015720 TMP21-related

The PANTHER Classification System

More...
PANTHERi
PTHR22811 PTHR22811, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01105 EMP24_GP25L, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01190 EMP24_GP25L, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF101576 SSF101576, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50866 GOLD, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y3Q3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSTVPRSAS VLLLLLLLRR AEQPCGAELT FELPDNAKQC FHEEVEQGVK
60 70 80 90 100
FSLDYQVITG GHYDVDCYVE DPQGNTIYRE TKKQYDSFTY RAEVKGVYQF
110 120 130 140 150
CFSNEFSTFS HKTVYFDFQV GDEPPILPDM GNRVTALTQM ESACVTIHEA
160 170 180 190 200
LKTVIDSQTH YRLREAQDRA RAEDLNSRVS YWSVGETIAL FVVSFSQVLL
210
LKSFFTEKRP ISRAVHS
Length:217
Mass (Da):24,777
Last modified:November 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i515C3F0B6C17EBDD
GO
Isoform 2 (identifier: Q9Y3Q3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     140-216: MESACVTIHE...EKRPISRAVH → RFRGAYWKEVDKMVDYMQPGGTPATEGLGRLAP

Show »
Length:173
Mass (Da):19,635
Checksum:i19B2AA92EC6F57B3
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H4M7F5H4M7_HUMAN
Transmembrane emp24 domain-containi...
TMED3
155Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V1J9G3V1J9_HUMAN
Transmembrane emp24 domain-containi...
TMED3 hCG_24828
146Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04911086D → N. Corresponds to variant dbSNP:rs3784543Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_044371140 – 216MESAC…SRAVH → RFRGAYWKEVDKMVDYMQPG GTPATEGLGRLAP in isoform 2. 1 PublicationAdd BLAST77

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ132270 mRNA Translation: CAB40416.1
AL109672 mRNA Translation: CAB52017.1
AY358974 mRNA Translation: AAQ89333.1
CR457384 mRNA Translation: CAG33665.1
AK289434 mRNA Translation: BAF82123.1
AK297710 mRNA Translation: BAG60067.1
AC011797 Genomic DNA No translation available.
AC027811 Genomic DNA No translation available.
BC000027 mRNA Translation: AAH00027.1
BC010853 mRNA Translation: AAH10853.1
BC017495 mRNA Translation: AAH17495.1
BC022232 mRNA Translation: AAH22232.1
BC111547 mRNA Translation: AAI11548.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10310.1 [Q9Y3Q3-1]
CCDS81914.1 [Q9Y3Q3-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001317305.1, NM_001330376.1 [Q9Y3Q3-2]
NP_031390.1, NM_007364.3 [Q9Y3Q3-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.513058
Hs.665470
Hs.71608

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000299705; ENSP00000299705; ENSG00000166557 [Q9Y3Q3-1]
ENST00000424155; ENSP00000414983; ENSG00000166557 [Q9Y3Q3-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23423

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23423

UCSC genome browser

More...
UCSCi
uc002beu.4 human [Q9Y3Q3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ132270 mRNA Translation: CAB40416.1
AL109672 mRNA Translation: CAB52017.1
AY358974 mRNA Translation: AAQ89333.1
CR457384 mRNA Translation: CAG33665.1
AK289434 mRNA Translation: BAF82123.1
AK297710 mRNA Translation: BAG60067.1
AC011797 Genomic DNA No translation available.
AC027811 Genomic DNA No translation available.
BC000027 mRNA Translation: AAH00027.1
BC010853 mRNA Translation: AAH10853.1
BC017495 mRNA Translation: AAH17495.1
BC022232 mRNA Translation: AAH22232.1
BC111547 mRNA Translation: AAI11548.1
CCDSiCCDS10310.1 [Q9Y3Q3-1]
CCDS81914.1 [Q9Y3Q3-2]
RefSeqiNP_001317305.1, NM_001330376.1 [Q9Y3Q3-2]
NP_031390.1, NM_007364.3 [Q9Y3Q3-1]
UniGeneiHs.513058
Hs.665470
Hs.71608

3D structure databases

ProteinModelPortaliQ9Y3Q3
SMRiQ9Y3Q3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116993, 18 interactors
IntActiQ9Y3Q3, 3 interactors
STRINGi9606.ENSP00000299705

Protein family/group databases

TCDBi9.B.188.1.3 the transmembrane emp24 domain-containing protein (tmed) family

PTM databases

iPTMnetiQ9Y3Q3
PhosphoSitePlusiQ9Y3Q3

Polymorphism and mutation databases

BioMutaiTMED3

Proteomic databases

EPDiQ9Y3Q3
PaxDbiQ9Y3Q3
PeptideAtlasiQ9Y3Q3
PRIDEiQ9Y3Q3
ProteomicsDBi86059

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000299705; ENSP00000299705; ENSG00000166557 [Q9Y3Q3-1]
ENST00000424155; ENSP00000414983; ENSG00000166557 [Q9Y3Q3-2]
GeneIDi23423
KEGGihsa:23423
UCSCiuc002beu.4 human [Q9Y3Q3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23423
DisGeNETi23423
EuPathDBiHostDB:ENSG00000166557.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TMED3
HGNCiHGNC:28889 TMED3
HPAiHPA049314
HPA076949
neXtProtiNX_Q9Y3Q3
OpenTargetsiENSG00000166557
PharmGKBiPA134958958

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1693 Eukaryota
ENOG4111JPD LUCA
GeneTreeiENSGT00940000159833
HOGENOMiHOG000160229
HOVERGENiHBG000271
InParanoidiQ9Y3Q3
KOiK20350
OMAiNYDVDCF
OrthoDBiEOG091G0LX8
PhylomeDBiQ9Y3Q3
TreeFamiTF313000

Enzyme and pathway databases

ReactomeiR-HSA-6807878 COPI-mediated anterograde transport
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TMED3 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23423

Protein Ontology

More...
PROi
PR:Q9Y3Q3

Gene expression databases

BgeeiENSG00000166557 Expressed in 221 organ(s), highest expression level in parotid gland
CleanExiHS_TMED3
ExpressionAtlasiQ9Y3Q3 baseline and differential
GenevisibleiQ9Y3Q3 HS

Family and domain databases

InterProiView protein in InterPro
IPR009038 GOLD_dom
IPR036598 GOLD_dom_sf
IPR015720 TMP21-related
PANTHERiPTHR22811 PTHR22811, 1 hit
PfamiView protein in Pfam
PF01105 EMP24_GP25L, 1 hit
SMARTiView protein in SMART
SM01190 EMP24_GP25L, 1 hit
SUPFAMiSSF101576 SSF101576, 1 hit
PROSITEiView protein in PROSITE
PS50866 GOLD, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTMED3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y3Q3
Secondary accession number(s): A8K069, B4DN05, Q2T9F8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2002
Last sequence update: November 1, 1999
Last modified: December 5, 2018
This is version 153 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again