Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transmembrane emp24 domain-containing protein 3

Gene

TMED3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Potential role in vesicular protein trafficking, mainly in the early secretory pathway. Contributes to the coupled localization of TMED2 and TMED10 in the cis-Golgi network.1 Publication

GO - Biological processi

Keywordsi

Biological processProtein transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-6807878 COPI-mediated anterograde transport
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic

Protein family/group databases

TCDBi9.B.188.1.3 the transmembrane emp24 domain-containing protein (tmed) family

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane emp24 domain-containing protein 3
Alternative name(s):
Membrane protein p24B
p24 family protein gamma-4
Short name:
p24gamma4
p26
Gene namesi
Name:TMED3
Synonyms:C15orf22
ORF Names:UNQ5357/PRO1078
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

EuPathDBiHostDB:ENSG00000166557.12
HGNCiHGNC:28889 TMED3
neXtProtiNX_Q9Y3Q3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini24 – 180LumenalSequence analysisAdd BLAST157
Transmembranei181 – 201HelicalSequence analysisAdd BLAST21
Topological domaini202 – 217CytoplasmicSequence analysisAdd BLAST16

Keywords - Cellular componenti

Cytoplasmic vesicle, Endoplasmic reticulum, Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi23423
OpenTargetsiENSG00000166557
PharmGKBiPA134958958

Polymorphism and mutation databases

BioMutaiTMED3

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 23Sequence analysisAdd BLAST23
ChainiPRO_000001038424 – 217Transmembrane emp24 domain-containing protein 3Add BLAST194

Proteomic databases

EPDiQ9Y3Q3
PaxDbiQ9Y3Q3
PeptideAtlasiQ9Y3Q3
PRIDEiQ9Y3Q3
ProteomicsDBi86059

PTM databases

iPTMnetiQ9Y3Q3
PhosphoSitePlusiQ9Y3Q3

Expressioni

Gene expression databases

BgeeiENSG00000166557
CleanExiHS_TMED3
ExpressionAtlasiQ9Y3Q3 baseline and differential
GenevisibleiQ9Y3Q3 HS

Organism-specific databases

HPAiHPA049314
HPA076949

Interactioni

Subunit structurei

Monomer in endoplasmic reticulum, endoplasmic reticulum-Golgi intermediate compartment and cis-Golgi network. Interacts (via C-terminus) with COPG1; the interaction involves dimeric TMED3; however, there are conflicting reports on the interaction. Interacts with GORASP1 and GORASP2 (By similarity).By similarity

Protein-protein interaction databases

BioGridi116993, 18 interactors
IntActiQ9Y3Q3, 3 interactors
STRINGi9606.ENSP00000299705

Structurei

3D structure databases

ProteinModelPortaliQ9Y3Q3
SMRiQ9Y3Q3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini38 – 120GOLDPROSITE-ProRule annotationAdd BLAST83

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi204 – 217COPI vesicle coat-bindingSequence analysisAdd BLAST14
Motifi204 – 205COPII vesicle coat-bindingSequence analysis2

Sequence similaritiesi

Belongs to the EMP24/GP25L family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1693 Eukaryota
ENOG4111JPD LUCA
GeneTreeiENSGT00670000097656
HOGENOMiHOG000160229
HOVERGENiHBG000271
InParanoidiQ9Y3Q3
KOiK20350
OMAiNYDVDCF
OrthoDBiEOG091G0LX8
PhylomeDBiQ9Y3Q3
TreeFamiTF313000

Family and domain databases

InterProiView protein in InterPro
IPR009038 GOLD_dom
IPR036598 GOLD_dom_sf
IPR015720 TMP21-related
PANTHERiPTHR22811 PTHR22811, 1 hit
PfamiView protein in Pfam
PF01105 EMP24_GP25L, 1 hit
SMARTiView protein in SMART
SM01190 EMP24_GP25L, 1 hit
SUPFAMiSSF101576 SSF101576, 1 hit
PROSITEiView protein in PROSITE
PS50866 GOLD, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y3Q3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGSTVPRSAS VLLLLLLLRR AEQPCGAELT FELPDNAKQC FHEEVEQGVK
60 70 80 90 100
FSLDYQVITG GHYDVDCYVE DPQGNTIYRE TKKQYDSFTY RAEVKGVYQF
110 120 130 140 150
CFSNEFSTFS HKTVYFDFQV GDEPPILPDM GNRVTALTQM ESACVTIHEA
160 170 180 190 200
LKTVIDSQTH YRLREAQDRA RAEDLNSRVS YWSVGETIAL FVVSFSQVLL
210
LKSFFTEKRP ISRAVHS
Length:217
Mass (Da):24,777
Last modified:November 1, 1999 - v1
Checksum:i515C3F0B6C17EBDD
GO
Isoform 2 (identifier: Q9Y3Q3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     140-216: MESACVTIHE...EKRPISRAVH → RFRGAYWKEVDKMVDYMQPGGTPATEGLGRLAP

Show »
Length:173
Mass (Da):19,635
Checksum:i19B2AA92EC6F57B3
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04911086D → N. Corresponds to variant dbSNP:rs3784543Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_044371140 – 216MESAC…SRAVH → RFRGAYWKEVDKMVDYMQPG GTPATEGLGRLAP in isoform 2. 1 PublicationAdd BLAST77

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ132270 mRNA Translation: CAB40416.1
AL109672 mRNA Translation: CAB52017.1
AY358974 mRNA Translation: AAQ89333.1
CR457384 mRNA Translation: CAG33665.1
AK289434 mRNA Translation: BAF82123.1
AK297710 mRNA Translation: BAG60067.1
AC011797 Genomic DNA No translation available.
AC027811 Genomic DNA No translation available.
BC000027 mRNA Translation: AAH00027.1
BC010853 mRNA Translation: AAH10853.1
BC017495 mRNA Translation: AAH17495.1
BC022232 mRNA Translation: AAH22232.1
BC111547 mRNA Translation: AAI11548.1
CCDSiCCDS10310.1 [Q9Y3Q3-1]
CCDS81914.1 [Q9Y3Q3-2]
RefSeqiNP_001317305.1, NM_001330376.1 [Q9Y3Q3-2]
NP_031390.1, NM_007364.3 [Q9Y3Q3-1]
UniGeneiHs.513058
Hs.665470
Hs.71608

Genome annotation databases

EnsembliENST00000299705; ENSP00000299705; ENSG00000166557 [Q9Y3Q3-1]
ENST00000424155; ENSP00000414983; ENSG00000166557 [Q9Y3Q3-2]
GeneIDi23423
KEGGihsa:23423
UCSCiuc002beu.4 human [Q9Y3Q3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiTMED3_HUMAN
AccessioniPrimary (citable) accession number: Q9Y3Q3
Secondary accession number(s): A8K069, B4DN05, Q2T9F8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2002
Last sequence update: November 1, 1999
Last modified: June 20, 2018
This is version 150 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health