Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 157 (13 Feb 2019)
Sequence version 3 (21 Aug 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Rab GTPase-activating protein 1

Gene

RABGAP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May act as a GTPase-activating protein of RAB6A. May play a role in microtubule nucleation by centrosome. May participate in a RAB6A-mediated pathway involved in the metaphase-anaphase transition.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei608Arginine fingerBy similarity1
Sitei649Glutamine fingerBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation
Biological processCell cycle

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8854214 TBC/RABGAPs

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rab GTPase-activating protein 1
Alternative name(s):
GAP and centrosome-associated protein
Rab6 GTPase-activating protein GAPCenA
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RABGAP1
ORF Names:HSPC094
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000011454.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17155 RABGAP1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615882 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y3P9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
23637

Open Targets

More...
OpenTargetsi
ENSG00000011454

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134977298

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RABGAP1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
156633605

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002987791 – 1069Rab GTPase-activating protein 1Add BLAST1069

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei42PhosphoserineCombined sources1
Modified residuei360PhosphoserineBy similarity1
Modified residuei996PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9Y3P9

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9Y3P9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y3P9

PeptideAtlas

More...
PeptideAtlasi
Q9Y3P9

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y3P9

ProteomicsDB human proteome resource

More...
ProteomicsDBi
86054
86055 [Q9Y3P9-2]
86056 [Q9Y3P9-3]
86057 [Q9Y3P9-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y3P9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y3P9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000011454 Expressed in 242 organ(s), highest expression level in secondary oocyte

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9Y3P9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Y3P9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA064860
HPA072273

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RAB6A and tubulin gamma.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
GABARAPL1Q9H0R82EBI-1057545,EBI-746969

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117166, 45 interactors

Protein interaction database and analysis system

More...
IntActi
Q9Y3P9, 16 interactors

Molecular INTeraction database

More...
MINTi
Q9Y3P9

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000362751

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11069
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4NC6X-ray1.80A536-849[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9Y3P9

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Y3P9

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini142 – 298PIDPROSITE-ProRule annotationAdd BLAST157
Domaini566 – 752Rab-GAP TBCPROSITE-ProRule annotationAdd BLAST187

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili798 – 1047Sequence analysisAdd BLAST250

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The arginine and glutamine fingers are critical for the GTPase-activating mechanism, they pull out Rab's 'switch 2' glutamine and insert in Rab's active site.By similarity

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1102 Eukaryota
COG5210 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157216

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000007923

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG063892

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y3P9

KEGG Orthology (KO)

More...
KOi
K20284

Database of Orthologous Groups

More...
OrthoDBi
324177at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y3P9

TreeFam database of animal gene trees

More...
TreeFami
TF317184

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR022164 Kinesin-like
IPR011993 PH-like_dom_sf
IPR006020 PTB/PI_dom
IPR000195 Rab-GTPase-TBC_dom
IPR035969 Rab-GTPase_TBC_sf
IPR033185 RabGAP1

The PANTHER Classification System

More...
PANTHERi
PTHR22957:SF205 PTHR22957:SF205, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12473 DUF3694, 1 hit
PF00640 PID, 1 hit
PF00566 RabGAP-TBC, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00462 PTB, 1 hit
SM00164 TBC, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47923 SSF47923, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01179 PID, 1 hit
PS50086 TBC_RABGAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q9Y3P9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDDKASVGKI SVSSDSVSTL NSEDFVLVSR QGDETPSTNN GSDDEKTGLK
60 70 80 90 100
IVGNGSEQQL QKELADVLMD PPMDDQPGEK ELVKRSQLDG EGDGPLSNQL
110 120 130 140 150
SASSTINPVP LVGLQKPEMS LPVKPGQGDS EASSPFTPVA DEDSVVFSKL
160 170 180 190 200
TYLGCASVNA PRSEVEALRM MSILRSQCQI SLDVTLSVPN VSEGIVRLLD
210 220 230 240 250
PQTNTEIANY PIYKILFCVR GHDGTPESDC FAFTESHYNA ELFRIHVFRC
260 270 280 290 300
EIQEAVSRIL YSFATAFRRS AKQTPLSATA APQTPDSDIF TFSVSLEIKE
310 320 330 340 350
DDGKGYFSAV PKDKDRQCFK LRQGIDKKIV IYVQQTTNKE LAIERCFGLL
360 370 380 390 400
LSPGKDVRNS DMHLLDLESM GKSSDGKSYV ITGSWNPKSP HFQVVNEETP
410 420 430 440 450
KDKVLFMTTA VDLVITEVQE PVRFLLETKV RVCSPNERLF WPFSKRSTTE
460 470 480 490 500
NFFLKLKQIK QRERKNNTDT LYEVVCLESE SERERRKTTA SPSVRLPQSG
510 520 530 540 550
SQSSVIPSPP EDDEEEDNDE PLLSGSGDVS KECAEKILET WGELLSKWHL
560 570 580 590 600
NLNVRPKQLS SLVRNGVPEA LRGEVWQLLA GCHNNDHLVE KYRILITKES
610 620 630 640 650
PQDSAITRDI NRTFPAHDYF KDTGGDGQDS LYKICKAYSV YDEEIGYCQG
660 670 680 690 700
QSFLAAVLLL HMPEEQAFSV LVKIMFDYGL RELFKQNFED LHCKFYQLER
710 720 730 740 750
LMQEYIPDLY NHFLDISLEA HMYASQWFLT LFTAKFPLYM VFHIIDLLLC
760 770 780 790 800
EGISVIFNVA LGLLKTSKDD LLLTDFEGAL KFFRVQLPKR YRSEENAKKL
810 820 830 840 850
MELACNMKIS QKKLKKYEKE YHTMREQQAQ QEDPIERFER ENRRLQEANM
860 870 880 890 900
RLEQENDDLA HELVTSKIAL RKDLDNAEEK ADALNKELLM TKQKLIDAEE
910 920 930 940 950
EKRRLEEESA QLKEMCRREL DKAESEIKKN SSIIGDYKQI CSQLSERLEK
960 970 980 990 1000
QQTANKVEIE KIRQKVDDCE RCREFFNKEG RVKGISSTKE VLDEDTDEEK
1010 1020 1030 1040 1050
ETLKNQLREM ELELAQTKLQ LVEAECKIQD LEHHLGLALN EVQAAKKTWF
1060
NRTLSSIKTA TGVQGKETC
Length:1,069
Mass (Da):121,737
Last modified:August 21, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF3B09BD3CF993F3A
GO
Isoform 21 Publication (identifier: Q9Y3P9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: Missing.
     637-667: AYSVYDEEIGYCQGQSFLAAVLLLHMPEEQA → VFHVKKKKDSILSGGSTLKLHKKQLQSVICI
     668-1069: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:599
Mass (Da):67,098
Checksum:i549686265A37B8BB
GO
Isoform 3 (identifier: Q9Y3P9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     480-1069: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:479
Mass (Da):53,195
Checksum:i56599C32796E7909
GO
Isoform 41 Publication (identifier: Q9Y3P9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     258-265: RILYSFAT → PQEKTLCK
     266-1069: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:265
Mass (Da):28,712
Checksum:i7BA5E80C1D8A71FF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H9NIL4H9NIL4_HUMAN
G protein-coupled receptor 21
RABGAP1
349Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B5MCD9B5MCD9_HUMAN
Rab GTPase-activating protein 1
RABGAP1
112Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JGR5C9JGR5_HUMAN
Rab GTPase-activating protein 1
RABGAP1
66Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF28917 differs from that shown. Reason: Frameshift at several positions.Curated
The sequence AAH20609 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH54492 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AK022408 differs from that shown. Intron retention.Curated
The sequence CAB40267 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0525101 – 68Missing in isoform 2. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_052511258 – 265RILYSFAT → PQEKTLCK in isoform 4. 1 Publication8
Alternative sequenceiVSP_052512266 – 1069Missing in isoform 4. 1 PublicationAdd BLAST804
Alternative sequenceiVSP_052515480 – 1069Missing in isoform 3. 1 PublicationAdd BLAST590
Alternative sequenceiVSP_052513637 – 667AYSVY…PEEQA → VFHVKKKKDSILSGGSTLKL HKKQLQSVICI in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_052514668 – 1069Missing in isoform 2. 1 PublicationAdd BLAST402

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ011679 mRNA Translation: CAB40267.2 Different initiation.
AB449897 mRNA Translation: BAH16640.1
AF161357 mRNA Translation: AAF28917.1 Frameshift.
AK022408 mRNA No translation available.
AK131449 mRNA Translation: BAD18594.1
AC007066 Genomic DNA No translation available.
AL365338 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87555.1
BC020609 mRNA Translation: AAH20609.1 Sequence problems.
BC054492 mRNA Translation: AAH54492.1 Different initiation.
AL050195 mRNA Translation: CAB43313.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS6848.2 [Q9Y3P9-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
T13163

NCBI Reference Sequences

More...
RefSeqi
NP_036329.3, NM_012197.3 [Q9Y3P9-1]
XP_011516742.1, XM_011518440.2 [Q9Y3P9-1]
XP_011516743.1, XM_011518441.2 [Q9Y3P9-1]
XP_016870056.1, XM_017014567.1 [Q9Y3P9-1]
XP_016870057.1, XM_017014568.1 [Q9Y3P9-1]
XP_016870058.1, XM_017014569.1 [Q9Y3P9-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.271341

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000373647; ENSP00000362751; ENSG00000011454 [Q9Y3P9-1]
ENST00000456584; ENSP00000414386; ENSG00000011454 [Q9Y3P9-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23637

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23637

UCSC genome browser

More...
UCSCi
uc011lzh.3 human [Q9Y3P9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ011679 mRNA Translation: CAB40267.2 Different initiation.
AB449897 mRNA Translation: BAH16640.1
AF161357 mRNA Translation: AAF28917.1 Frameshift.
AK022408 mRNA No translation available.
AK131449 mRNA Translation: BAD18594.1
AC007066 Genomic DNA No translation available.
AL365338 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87555.1
BC020609 mRNA Translation: AAH20609.1 Sequence problems.
BC054492 mRNA Translation: AAH54492.1 Different initiation.
AL050195 mRNA Translation: CAB43313.1
CCDSiCCDS6848.2 [Q9Y3P9-1]
PIRiT13163
RefSeqiNP_036329.3, NM_012197.3 [Q9Y3P9-1]
XP_011516742.1, XM_011518440.2 [Q9Y3P9-1]
XP_011516743.1, XM_011518441.2 [Q9Y3P9-1]
XP_016870056.1, XM_017014567.1 [Q9Y3P9-1]
XP_016870057.1, XM_017014568.1 [Q9Y3P9-1]
XP_016870058.1, XM_017014569.1 [Q9Y3P9-1]
UniGeneiHs.271341

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4NC6X-ray1.80A536-849[»]
ProteinModelPortaliQ9Y3P9
SMRiQ9Y3P9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117166, 45 interactors
IntActiQ9Y3P9, 16 interactors
MINTiQ9Y3P9
STRINGi9606.ENSP00000362751

PTM databases

iPTMnetiQ9Y3P9
PhosphoSitePlusiQ9Y3P9

Polymorphism and mutation databases

BioMutaiRABGAP1
DMDMi156633605

Proteomic databases

EPDiQ9Y3P9
jPOSTiQ9Y3P9
PaxDbiQ9Y3P9
PeptideAtlasiQ9Y3P9
PRIDEiQ9Y3P9
ProteomicsDBi86054
86055 [Q9Y3P9-2]
86056 [Q9Y3P9-3]
86057 [Q9Y3P9-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000373647; ENSP00000362751; ENSG00000011454 [Q9Y3P9-1]
ENST00000456584; ENSP00000414386; ENSG00000011454 [Q9Y3P9-2]
GeneIDi23637
KEGGihsa:23637
UCSCiuc011lzh.3 human [Q9Y3P9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23637
DisGeNETi23637
EuPathDBiHostDB:ENSG00000011454.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RABGAP1

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0008361
HGNCiHGNC:17155 RABGAP1
HPAiHPA064860
HPA072273
MIMi615882 gene
neXtProtiNX_Q9Y3P9
OpenTargetsiENSG00000011454
PharmGKBiPA134977298

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1102 Eukaryota
COG5210 LUCA
GeneTreeiENSGT00940000157216
HOGENOMiHOG000007923
HOVERGENiHBG063892
InParanoidiQ9Y3P9
KOiK20284
OrthoDBi324177at2759
PhylomeDBiQ9Y3P9
TreeFamiTF317184

Enzyme and pathway databases

ReactomeiR-HSA-8854214 TBC/RABGAPs

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RABGAP1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
RABGAP1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23637

Protein Ontology

More...
PROi
PR:Q9Y3P9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000011454 Expressed in 242 organ(s), highest expression level in secondary oocyte
ExpressionAtlasiQ9Y3P9 baseline and differential
GenevisibleiQ9Y3P9 HS

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR022164 Kinesin-like
IPR011993 PH-like_dom_sf
IPR006020 PTB/PI_dom
IPR000195 Rab-GTPase-TBC_dom
IPR035969 Rab-GTPase_TBC_sf
IPR033185 RabGAP1
PANTHERiPTHR22957:SF205 PTHR22957:SF205, 1 hit
PfamiView protein in Pfam
PF12473 DUF3694, 1 hit
PF00640 PID, 1 hit
PF00566 RabGAP-TBC, 1 hit
SMARTiView protein in SMART
SM00462 PTB, 1 hit
SM00164 TBC, 1 hit
SUPFAMiSSF47923 SSF47923, 2 hits
PROSITEiView protein in PROSITE
PS01179 PID, 1 hit
PS50086 TBC_RABGAP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRBGP1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y3P9
Secondary accession number(s): B9A6L2
, Q05CW2, Q6ZMY1, Q9HA28, Q9P0E2, Q9UG67
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: August 21, 2007
Last modified: February 13, 2019
This is version 157 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again