Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9Y3C4 (TPRKB_HUMAN)

Entry version 147 (10 Feb 2021)
Sequence version 1 (01 Nov 1999)
Previous versions | rss
Add a publicationFeedback
Protein

EKC/KEOPS complex subunit TPRKB

Gene

TPRKB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t6A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:28805828). The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37 (PubMed:22912744, PubMed:28805828). TPRKB acts as an allosteric effector that regulates the t6A activity of the complex. TPRKB is not required for tRNA modification (PubMed:22912744, PubMed:28805828).1 Publication1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processtRNA processing

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9Y3C4

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-6782315, tRNA modification in the nucleus and cytosol

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
EKC/KEOPS complex subunit TPRKBCurated
Alternative name(s):
PRPK-binding protein1 Publication
TP53RK-binding protein1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TPRKBImported
ORF Names:CGI-1212 Publications, My019
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:24259, TPRKB

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		608680, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9Y3C4

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000144034.14

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Galloway-Mowat syndrome 5 (GAMOS5)1 Publication
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA form of Galloway-Mowat syndrome, a severe renal-neurological disease characterized by early-onset nephrotic syndrome associated with microcephaly, central nervous system abnormalities, developmental delays, and a propensity for seizures. Brain anomalies include gyration defects ranging from lissencephaly to pachygyria and polymicrogyria, and cerebellar hypoplasia. Most patients show facial dysmorphism characterized by a small, narrow forehead, large/floppy ears, deep-set eyes, hypertelorism and micrognathia. Additional variable features are visual impairment and arachnodactyly. Most patients die in early childhood.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_080355136L → P in GAMOS5. 1 PublicationCorresponds to variant dbSNP:rs1553433412EnsemblClinVar.1
Natural variantiVAR_080356149Y → C in GAMOS5. 1 PublicationCorresponds to variant dbSNP:rs1233885358EnsemblClinVar.1

Keywords - Diseasei

Disease variant, Epilepsy, Mental retardation

Organism-specific databases

DisGeNET

More...DisGeNETi		51002

MalaCards human disease database

More...MalaCardsi		TPRKB
MIMi617731, phenotype

Open Targets

More...OpenTargetsi		ENSG00000144034

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		2065, Galloway-Mowat syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA143485660

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9Y3C4, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TPRKB

Domain mapping of disease mutations (DMDM)

More...DMDMi		74735252

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002792201 – 175EKC/KEOPS complex subunit TPRKBAdd BLAST175

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9Y3C4

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9Y3C4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9Y3C4

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9Y3C4

PeptideAtlas

More...PeptideAtlasi		Q9Y3C4

PRoteomics IDEntifications database

More...PRIDEi		Q9Y3C4

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		86011 [Q9Y3C4-1]
86012 [Q9Y3C4-2]
86013 [Q9Y3C4-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9Y3C4

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q9Y3C4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9Y3C4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000144034, Expressed in quadriceps femoris and 238 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9Y3C4, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000144034, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the EKC/KEOPS complex composed of at least GON7, TP53RK, TPRKB, OSGEP and LAGE3; the whole complex dimerizes (PubMed:22912744, PubMed:28805828).

Interacts with TP53RK/PRPK (PubMed:12659830).

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		119210, 46 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q9Y3C4

Protein interaction database and analysis system

More...IntActi		Q9Y3C4, 11 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000272424

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9Y3C4, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1175
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9Y3C4

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q9Y3C4

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CGI121/TPRKB family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4066, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000012942

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_065847_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9Y3C4

Identification of Orthologs from Complete Genome Data

More...OMAi		VCRMATK

Database of Orthologous Groups

More...OrthoDBi		1360669at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9Y3C4

TreeFam database of animal gene trees

More...TreeFami		TF315098

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.2380.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR013926, CGI121/TPRKB
IPR036504, CGI121/TPRKB_sf

The PANTHER Classification System

More...PANTHERi		PTHR15840, PTHR15840, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF08617, CGI-121, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF143870, SSF143870, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9Y3C4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQLTHQLDLF PECRVTLLLF KDVKNAGDLR RKAMEGTIDG SLINPTVIVD 
        60         70         80         90        100
PFQILVAANK AVHLYKLGKM KTRTLSTEII FNLSPNNNIS EALKKFGISA 
       110        120        130        140        150
NDTSILIVYI EEGEKQINQE YLISQVEGHQ VSLKNLPEIM NITEVKKIYK 
       160        170 
LSSQEESIGT LLDAIICRMS TKDVL
Length:175
Mass (Da):19,661
Last modified:November 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFB13C0923148C157
GO
Isoform 2 (identifier: Q9Y3C4-2) [UniParc]FASTAAdd to basket
Also known as: S1

The sequence of this isoform differs from the canonical sequence as follows:
     15-47: Missing.

Show »
Length:142
Mass (Da):16,093
Checksum:i12388A00E0205E07
GO
Isoform 3 (identifier: Q9Y3C4-3) [UniParc]FASTAAdd to basket
Also known as: L1

The sequence of this isoform differs from the canonical sequence as follows:
     47-47: V → VFHSCCPGWSAMARSWLTATSASRVQAIVLPQPPELLGLQ

Show »
Length:214
Mass (Da):23,854
Checksum:i8961692D7DF630C7
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti147K → R in AAG43133 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_080355136L → P in GAMOS5. 1 PublicationCorresponds to variant dbSNP:rs1553433412EnsemblClinVar.1
Natural variantiVAR_080356149Y → C in GAMOS5. 1 PublicationCorresponds to variant dbSNP:rs1233885358EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_02341415 – 47Missing in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_02341547V → VFHSCCPGWSAMARSWLTAT SASRVQAIVLPQPPELLGLQ in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY157986 mRNA Translation: AAN76356.1
AY157987 mRNA Translation: AAN76357.1
AF060921 mRNA Translation: AAG43133.1
AF151879 mRNA Translation: AAD34116.1
CH471053 Genomic DNA Translation: EAW99720.1
CH471053 Genomic DNA Translation: EAW99722.1
BC029492 mRNA Translation: AAH29492.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS1927.1 [Q9Y3C4-1]
CCDS82471.1 [Q9Y3C4-3]

NCBI Reference Sequences

More...RefSeqi		NP_001317315.1, NM_001330386.1 [Q9Y3C4-3]
NP_001317316.1, NM_001330387.1 [Q9Y3C4-3]
NP_001317317.1, NM_001330388.1 [Q9Y3C4-1]
NP_001317318.1, NM_001330389.1 [Q9Y3C4-1]
NP_001317320.1, NM_001330391.1 [Q9Y3C4-2]
NP_001317321.1, NM_001330392.1 [Q9Y3C4-2]
NP_057142.1, NM_016058.3 [Q9Y3C4-1]
XP_006712090.1, XM_006712027.3
XP_011531179.1, XM_011532877.2
XP_011531180.1, XM_011532878.2
XP_016859721.1, XM_017004232.1
XP_016859722.1, XM_017004233.1
XP_016859723.1, XM_017004234.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000272424; ENSP00000272424; ENSG00000144034 [Q9Y3C4-1]
ENST00000318190; ENSP00000325398; ENSG00000144034 [Q9Y3C4-3]
ENST00000409716; ENSP00000386936; ENSG00000144034 [Q9Y3C4-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		51002

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:51002

UCSC genome browser

More...UCSCi		uc002sjn.3, human [Q9Y3C4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY157986 mRNA Translation: AAN76356.1
AY157987 mRNA Translation: AAN76357.1
AF060921 mRNA Translation: AAG43133.1
AF151879 mRNA Translation: AAD34116.1
CH471053 Genomic DNA Translation: EAW99720.1
CH471053 Genomic DNA Translation: EAW99722.1
BC029492 mRNA Translation: AAH29492.1
CCDSiCCDS1927.1 [Q9Y3C4-1]
CCDS82471.1 [Q9Y3C4-3]
RefSeqiNP_001317315.1, NM_001330386.1 [Q9Y3C4-3]
NP_001317316.1, NM_001330387.1 [Q9Y3C4-3]
NP_001317317.1, NM_001330388.1 [Q9Y3C4-1]
NP_001317318.1, NM_001330389.1 [Q9Y3C4-1]
NP_001317320.1, NM_001330391.1 [Q9Y3C4-2]
NP_001317321.1, NM_001330392.1 [Q9Y3C4-2]
NP_057142.1, NM_016058.3 [Q9Y3C4-1]
XP_006712090.1, XM_006712027.3
XP_011531179.1, XM_011532877.2
XP_011531180.1, XM_011532878.2
XP_016859721.1, XM_017004232.1
XP_016859722.1, XM_017004233.1
XP_016859723.1, XM_017004234.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3ENPX-ray2.48A/B1-175[»]
SMRiQ9Y3C4
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi119210, 46 interactors
CORUMiQ9Y3C4
IntActiQ9Y3C4, 11 interactors
STRINGi9606.ENSP00000272424

PTM databases

iPTMnetiQ9Y3C4
MetOSiteiQ9Y3C4
PhosphoSitePlusiQ9Y3C4

Genetic variation databases

BioMutaiTPRKB
DMDMi74735252

Proteomic databases

EPDiQ9Y3C4
jPOSTiQ9Y3C4
MassIVEiQ9Y3C4
PaxDbiQ9Y3C4
PeptideAtlasiQ9Y3C4
PRIDEiQ9Y3C4
ProteomicsDBi86011 [Q9Y3C4-1]
86012 [Q9Y3C4-2]
86013 [Q9Y3C4-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		31361, 215 antibodies

The DNASU plasmid repository

More...DNASUi		51002

Genome annotation databases

EnsembliENST00000272424; ENSP00000272424; ENSG00000144034 [Q9Y3C4-1]
ENST00000318190; ENSP00000325398; ENSG00000144034 [Q9Y3C4-3]
ENST00000409716; ENSP00000386936; ENSG00000144034 [Q9Y3C4-3]
GeneIDi51002
KEGGihsa:51002
UCSCiuc002sjn.3, human [Q9Y3C4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		51002
DisGeNETi51002

GeneCards: human genes, protein and diseases

More...GeneCardsi		TPRKB
HGNCiHGNC:24259, TPRKB
HPAiENSG00000144034, Low tissue specificity
MalaCardsiTPRKB
MIMi608680, gene
617731, phenotype
neXtProtiNX_Q9Y3C4
OpenTargetsiENSG00000144034
Orphaneti2065, Galloway-Mowat syndrome
PharmGKBiPA143485660
VEuPathDBiHostDB:ENSG00000144034.14

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG4066, Eukaryota
GeneTreeiENSGT00390000012942
HOGENOMiCLU_065847_2_0_1
InParanoidiQ9Y3C4
OMAiVCRMATK
OrthoDBi1360669at2759
PhylomeDBiQ9Y3C4
TreeFamiTF315098

Enzyme and pathway databases

PathwayCommonsiQ9Y3C4
ReactomeiR-HSA-6782315, tRNA modification in the nucleus and cytosol

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		51002, 411 hits in 871 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		TPRKB, human
EvolutionaryTraceiQ9Y3C4

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		51002
PharosiQ9Y3C4, Tbio

Protein Ontology

More...PROi		PR:Q9Y3C4
RNActiQ9Y3C4, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000144034, Expressed in quadriceps femoris and 238 other tissues
GenevisibleiQ9Y3C4, HS

Family and domain databases

Gene3Di3.30.2380.10, 1 hit
InterProiView protein in InterPro
IPR013926, CGI121/TPRKB
IPR036504, CGI121/TPRKB_sf
PANTHERiPTHR15840, PTHR15840, 1 hit
PfamiView protein in Pfam
PF08617, CGI-121, 1 hit
SUPFAMiSSF143870, SSF143870, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTPRKB_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y3C4
Secondary accession number(s): D6W5H6
, Q8IWR6, Q8IWR7, Q9H3K4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 6, 2007
Last sequence update: November 1, 1999
Last modified: February 10, 2021
This is version 147 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again