UniProtKB - Q9Y376 (CAB39_HUMAN)

BLAST

>sp|Q9Y376|CAB39_HUMAN Calcium-binding protein 39 OS=Homo sapiens OX=9606 GN=CAB39 PE=1 SV=1
MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEK
EPQTEAVAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYI
CTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDI
ASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDR
HNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQA
KLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPAQQEA

Align
Format
Add to basket Added to basket
History
Entry version 161 (07 Nov 2018)
Sequence version 1 (01 Nov 1999)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Calcium-binding protein 39

Gene

CAB39

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Component of a complex that binds and activates STK11/LKB1. In the complex, required to stabilize the interaction between CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta) and STK11/LKB1.1 Publication

GO - Molecular functionⁱ

kinase binding
Source: BHF-UCL
Inferred from physical interactionⁱ
- 19892943
protein kinase activator activity
Source: UniProtKB
Inferred from direct assayⁱ
- 19892943
protein serine/threonine kinase activator activity
Source: ParkinsonsUK-UCL
Inferred from direct assayⁱ
- 19892943
- 24393035
protein serine/threonine kinase activity Source: Ensembl

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

cell cycle arrest Source: Reactome
cellular hypotonic response
Source: ParkinsonsUK-UCL
Inferred by curatorⁱ
- 24393035
intracellular signal transduction
Source: ParkinsonsUK-UCL
Inferred from direct assayⁱ
- 24393035
negative regulation of potassium ion transmembrane transport
Source: ParkinsonsUK-UCL
Inferred by curatorⁱ
- 24393035
negative regulation of potassium ion transmembrane transporter activity
Source: ParkinsonsUK-UCL
Inferred by curatorⁱ
- 24393035
neutrophil degranulation Source: Reactome
peptidyl-serine phosphorylation
Source: ParkinsonsUK-UCL
Inferred from direct assayⁱ
- 24393035
positive regulation of peptidyl-threonine phosphorylation
Source: ParkinsonsUK-UCL
Inferred from direct assayⁱ
- 24393035
positive regulation of protein serine/threonine kinase activity
Source: ParkinsonsUK-UCL
Inferred from direct assayⁱ
- 19892943
- 24393035
protein heterooligomerization Source: Ensembl
signal transduction by protein phosphorylation
Source: ParkinsonsUK-UCL
Inferred from direct assayⁱ
- 24393035

View the complete GO annotation on QuickGO ...

Enzyme and pathway databases

Reactomeⁱ	R-HSA-380972 Energy dependent regulation of mTOR by LKB1-AMPK R-HSA-6798695 Neutrophil degranulation

Reactomeⁱ

R-HSA-380972 Energy dependent regulation of mTOR by LKB1-AMPK
R-HSA-6798695 Neutrophil degranulation

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Calcium-binding protein 39 Alternative name(s): MO25alpha Protein Mo25
Gene namesⁱ	Name:CAB39 Synonyms:MO25 ORF Names:CGI-66
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 2

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000135932.10
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:20292 CAB39
MIMⁱ	612174 gene
neXtProtⁱ	NX_Q9Y376

Keywords - Cellular componentⁱ

Cytoplasm

Pathology & Biotechⁱ

Mutagenesis

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Mutagenesisⁱ	240	R → A: Abolishes activation of STK11/LKB1; when associated with A-243. 1 Publication		1
Mutagenesisⁱ	243	F → A: Abolishes activation of STK11/LKB1; when associated with A-240. 1 Publication		1

Organism-specific databases

DisGeNET More...DisGeNETⁱ	51719
Open Targets More...OpenTargetsⁱ	ENSG00000135932
PharmGKBⁱ	PA128394663

Chemistry databases

ChEMBLⁱ	CHEMBL3885534

ChEMBLⁱ

CHEMBL3885534

Polymorphism and mutation databases

BioMutaⁱ	CAB39
DMDMⁱ	15214082

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000209824	1 – 341	Calcium-binding protein 39Add BLAST		341

Proteomic databases

EPDⁱ	Q9Y376
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	Q9Y376
PaxDbⁱ	Q9Y376
PeptideAtlas More...PeptideAtlasⁱ	Q9Y376
PRIDEⁱ	Q9Y376
ProteomicsDBⁱ	85981

PTM databases

iPTMnetⁱ	Q9Y376
PhosphoSitePlusⁱ	Q9Y376

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000135932 Expressed in 230 organ(s), highest expression level in middle temporal gyrus
CleanExⁱ	HS_CAB39
ExpressionAtlasⁱ	Q9Y376 baseline and differential
Genevisibleⁱ	Q9Y376 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	CAB037112

HPAⁱ

CAB037112

Interactionⁱ

Subunit structureⁱ

Component of a trimeric complex composed of STK11/LKB1, STRAD (STRADA or STRADB) and CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta): the complex tethers STK11/LKB1 in the cytoplasm and stimulates its catalytic activity.1 Publication

Binary interactionsⁱ

With	Entry	#Exp.	IntAct
OXSR1	O95747	3	EBI-306905,EBI-620853
STK11	Q15831	12	EBI-306905,EBI-306838
STK25	O00506	3	EBI-306905,EBI-618295
STK26	Q9P289	6	EBI-306905,EBI-618239
STK26	Q9P289-1	10	EBI-306905,EBI-15996971
STK39	Q9UEW8	4	EBI-306905,EBI-2680974
STRADA	Q7RTN6	3	EBI-306905,EBI-1109114
STRADA	Q7RTN6-1	7	EBI-306905,EBI-15787241
STRADB	Q9C0K7	5	EBI-306905,EBI-306893

GO - Molecular functionⁱ

kinase binding
Source: BHF-UCL
Inferred from physical interactionⁱ
- 19892943

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	119696, 39 interactors
CORUMⁱ	Q9Y376
Database of interacting proteins More...DIPⁱ	DIP-31316N
IntActⁱ	Q9Y376, 16 interactors
Molecular INTeraction database More...MINTⁱ	Q9Y376
STRINGⁱ	9606.ENSP00000258418

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	12 – 27	Combined sources	16
Beta strandⁱ	29 – 31	Combined sources	3
Helixⁱ	34 – 54	Combined sources	21
Beta strandⁱ	58 – 61	Combined sources	4
Helixⁱ	64 – 77	Combined sources	14
Helixⁱ	79 – 85	Combined sources	7
Helixⁱ	87 – 89	Combined sources	3
Helixⁱ	92 – 106	Combined sources	15
Helixⁱ	115 – 121	Combined sources	7
Helixⁱ	125 – 132	Combined sources	8
Helixⁱ	133 – 135	Combined sources	3
Turnⁱ	137 – 139	Combined sources	3
Helixⁱ	140 – 151	Combined sources	12
Helixⁱ	154 – 162	Combined sources	9
Helixⁱ	164 – 167	Combined sources	4
Helixⁱ	168 – 172	Combined sources	5
Helixⁱ	178 – 193	Combined sources	16
Helixⁱ	196 – 205	Combined sources	10
Helixⁱ	207 – 217	Combined sources	11
Helixⁱ	223 – 238	Combined sources	16
Helixⁱ	240 – 242	Combined sources	3
Helixⁱ	243 – 249	Combined sources	7
Helixⁱ	253 – 262	Combined sources	10
Helixⁱ	268 – 283	Combined sources	16
Helixⁱ	289 – 297	Combined sources	9
Helixⁱ	299 – 308	Combined sources	10
Turnⁱ	309 – 312	Combined sources	4
Helixⁱ	314 – 316	Combined sources	3
Helixⁱ	318 – 331	Combined sources	14

Show more details

3D structure databases

ProteinModelPortalⁱ	Q9Y376
SMRⁱ	Q9Y376
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	Q9Y376

EvolutionaryTraceⁱ

Q9Y376

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the Mo25 family.Curated

Phylogenomic databases

eggNOGⁱ	KOG1566 Eukaryota ENOG410XP4S LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000004360
HOGENOMⁱ	HOG000234711
HOVERGENⁱ	HBG050757
InParanoidⁱ	Q9Y376
KEGG Orthology (KO) More...KOⁱ	K08272
OMAⁱ	KNYDRFF
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0DTL
PhylomeDBⁱ	Q9Y376
TreeFamⁱ	TF314910

Family and domain databases

Gene3Dⁱ	1.25.10.10, 1 hit
InterProⁱ	View protein in InterPro IPR011989 ARM-like IPR016024 ARM-type_fold IPR013878 Mo25
PANTHERⁱ	PTHR10182 PTHR10182, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF08569 Mo25, 1 hit
SUPFAMⁱ	SSF48371 SSF48371, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 1 potential isoform that is computationally mapped.Show all Align All

Q9Y376-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MPFPFGKSHK SPADIVKNLK ESMAVLEKQD ISDKKAEKAT EEVSKNLVAM 
        60         70         80         90        100
KEILYGTNEK EPQTEAVAQL AQELYNSGLL STLVADLQLI DFEGKKDVAQ 
       110        120        130        140        150
IFNNILRRQI GTRTPTVEYI CTQQNILFML LKGYESPEIA LNCGIMLREC 
       160        170        180        190        200
IRHEPLAKII LWSEQFYDFF RYVEMSTFDI ASDAFATFKD LLTRHKLLSA 
       210        220        230        240        250
EFLEQHYDRF FSEYEKLLHS ENYVTKRQSL KLLGELLLDR HNFTIMTKYI 
       260        270        280        290        300
SKPENLKLMM NLLRDKSRNI QFEAFHVFKV FVANPNKTQP ILDILLKNQA 
       310        320        330        340 
KLIEFLSKFQ NDRTEDEQFN DEKTYLVKQI RDLKRPAQQE A

Length:341

Mass (Da):39,869

Last modified:November 1, 1999 - v1

Checksum:ⁱEC710A528B6F9811

Computationally mapped potential isoform sequencesⁱ

There is 1 potential isoform mapped to this entry.BLAST Align Show all Add to basket

	Entry	Entry name		Protein names	Gene names	Length	Annotation

	A0A087X0K1	A0A087X0K1_HUMAN		Calcium-binding protein 39 Calcium-binding protein 39	CAB39	339	Annotation score:

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF151824 mRNA Translation: AAD34061.1 AF113536 mRNA Translation: AAF14873.1 AK292382 mRNA Translation: BAF85071.1 AK315692 mRNA Translation: BAG38055.1 CH471063 Genomic DNA Translation: EAW70932.1 BC020570 mRNA Translation: AAH20570.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS2478.1
NCBI Reference Sequences More...RefSeqⁱ	NP_001124321.1, NM_001130849.1 NP_001124322.1, NM_001130850.1 NP_057373.1, NM_016289.3
UniGeneⁱ	Hs.603930

Genome annotation databases

Ensemblⁱ	ENST00000258418; ENSP00000258418; ENSG00000135932 ENST00000409788; ENSP00000386238; ENSG00000135932 ENST00000410084; ENSP00000386642; ENSG00000135932
GeneIDⁱ	51719
KEGGⁱ	hsa:51719
UCSC genome browser More...UCSCⁱ	uc002vqx.4 human

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q9Y376	Calcium-binding protein 39		BOVIN		341	UniRef100_Q9Y376
Calcium binding protein 39, isoform CRA_a		HUMAN		341
CAB39 isoform 1		PANTR		341
Uncharacterized protein		SHEEP		341
Uncharacterized protein		PANPA		341
+5

Protein	Similar proteins		Species	Score	Length	Source
Q9Y376	Calcium-binding protein 39		BOVIN		341	UniRef90_Q9Y376
Calcium binding protein 39, isoform CRA_a		HUMAN		341
CAB39 isoform 1		PANTR		341
Uncharacterized protein		SHEEP		341
Uncharacterized protein		PANPA		341
+101

Protein	Similar proteins		Species	Score	Length	Source
Q9Y376	Calcium-binding protein 39		BOVIN		341	UniRef50_Q9Y376
Calcium binding protein 39, isoform CRA_a		HUMAN		341
CAB39 isoform 1		PANTR		341
Uncharacterized protein		SHEEP		341
Uncharacterized protein		PANPA		341
+112

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF151824 mRNA Translation: AAD34061.1 AF113536 mRNA Translation: AAF14873.1 AK292382 mRNA Translation: BAF85071.1 AK315692 mRNA Translation: BAG38055.1 CH471063 Genomic DNA Translation: EAW70932.1 BC020570 mRNA Translation: AAH20570.1
CCDSⁱ	CCDS2478.1
RefSeqⁱ	NP_001124321.1, NM_001130849.1 NP_001124322.1, NM_001130850.1 NP_057373.1, NM_016289.3
UniGeneⁱ	Hs.603930

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1UPK	X-ray	1.85	A	1-341	[»]
	1UPL	X-ray	2.60	A/B	1-341	[»]
	2WTK	X-ray	2.65	A/D	1-341	[»]
	3GNI	X-ray	2.35	A	1-341	[»]
	4FZA	X-ray	3.15	A	11-334	[»]
	4FZD	X-ray	3.25	A	11-334	[»]
	4FZF	X-ray	3.64	A	11-334	[»]
	4NZW	X-ray	3.58	A	8-334	[»]
	4O27	X-ray	3.18	A	11-333	[»]
ProteinModelPortalⁱ	Q9Y376
SMRⁱ	Q9Y376
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	119696, 39 interactors
CORUMⁱ	Q9Y376
DIPⁱ	DIP-31316N
IntActⁱ	Q9Y376, 16 interactors
MINTⁱ	Q9Y376
STRINGⁱ	9606.ENSP00000258418

Chemistry databases

ChEMBLⁱ	CHEMBL3885534

ChEMBLⁱ

CHEMBL3885534

PTM databases

iPTMnetⁱ	Q9Y376
PhosphoSitePlusⁱ	Q9Y376

Polymorphism and mutation databases

BioMutaⁱ	CAB39
DMDMⁱ	15214082

Proteomic databases

EPDⁱ	Q9Y376
MaxQBⁱ	Q9Y376
PaxDbⁱ	Q9Y376
PeptideAtlasⁱ	Q9Y376
PRIDEⁱ	Q9Y376
ProteomicsDBⁱ	85981

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENST00000258418; ENSP00000258418; ENSG00000135932 ENST00000409788; ENSP00000386238; ENSG00000135932 ENST00000410084; ENSP00000386642; ENSG00000135932
GeneIDⁱ	51719
KEGGⁱ	hsa:51719
UCSCⁱ	uc002vqx.4 human

Organism-specific databases

CTDⁱ	51719
DisGeNETⁱ	51719
EuPathDBⁱ	HostDB:ENSG00000135932.10
GeneCardsⁱ	CAB39
HGNCⁱ	HGNC:20292 CAB39
HPAⁱ	CAB037112
MIMⁱ	612174 gene
neXtProtⁱ	NX_Q9Y376
OpenTargetsⁱ	ENSG00000135932
PharmGKBⁱ	PA128394663
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG1566 Eukaryota ENOG410XP4S LUCA
GeneTreeⁱ	ENSGT00390000004360
HOGENOMⁱ	HOG000234711
HOVERGENⁱ	HBG050757
InParanoidⁱ	Q9Y376
KOⁱ	K08272
OMAⁱ	KNYDRFF
OrthoDBⁱ	EOG091G0DTL
PhylomeDBⁱ	Q9Y376
TreeFamⁱ	TF314910

Enzyme and pathway databases

Reactomeⁱ	R-HSA-380972 Energy dependent regulation of mTOR by LKB1-AMPK R-HSA-6798695 Neutrophil degranulation

Reactomeⁱ

R-HSA-380972 Energy dependent regulation of mTOR by LKB1-AMPK
R-HSA-6798695 Neutrophil degranulation

Miscellaneous databases

ChiTaRSⁱ	CAB39 human
EvolutionaryTraceⁱ	Q9Y376
GeneWikiⁱ	CAB39
GenomeRNAiⁱ	51719
Protein Ontology More...PROⁱ	PR:Q9Y376
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000135932 Expressed in 230 organ(s), highest expression level in middle temporal gyrus
CleanExⁱ	HS_CAB39
ExpressionAtlasⁱ	Q9Y376 baseline and differential
Genevisibleⁱ	Q9Y376 HS

Family and domain databases

Gene3Dⁱ	1.25.10.10, 1 hit
InterProⁱ	View protein in InterPro IPR011989 ARM-like IPR016024 ARM-type_fold IPR013878 Mo25
PANTHERⁱ	PTHR10182 PTHR10182, 1 hit
Pfamⁱ	View protein in Pfam PF08569 Mo25, 1 hit
SUPFAMⁱ	SSF48371 SSF48371, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	CAB39_HUMAN
Accessionⁱ	Q9Y376Primary (citable) accession number: Q9Y376 Secondary accession number(s): A8K8L7
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	August 14, 2001
	Last sequence update:	November 1, 1999
	Last modified:	November 7, 2018
	This is version 161 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human chromosome 2
Human chromosome 2: entries, gene names and cross-references to MIM
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q9Y376 (CAB39_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Calcium-binding protein 39

CAB39

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Other locations

Cytosol

Extracellular region or secreted

Other locations

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Organism-specific databases

Chemistry databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ