Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 163 (12 Aug 2020)
Sequence version 1 (01 Nov 1999)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Thioredoxin-related transmembrane protein 2

Gene

TMX2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Endoplasmic reticulum and mitochondria-associated protein that probably functions as a regulator of cellular redox state and thereby regulates protein post-translational modification, protein folding and mitochondrial activity. Indirectly regulates neuronal proliferation, migration, and organization in the developing brain.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9Y320

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.I.1.1.3, the nuclear pore complex (npc) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Thioredoxin-related transmembrane protein 2
Alternative name(s):
Cell proliferation-inducing gene 26 protein
Thioredoxin domain-containing protein 14
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TMX2
Synonyms:TXNDC14
ORF Names:CGI-31, My009, PIG26, PSEC0045, UNQ237/PRO270
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000213593.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30739, TMX2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616715, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y320

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini49 – 102ExtracellularSequence analysisAdd BLAST54
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei103 – 125HelicalSequence analysisAdd BLAST23
Topological domaini126 – 296CytoplasmicSequence analysisAdd BLAST171

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Mitochondrion

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Neurodevelopmental disorder with microcephaly, cortical malformations, and spasticity (NEDMCMS)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive neurodevelopmental disorder characterized by developmental delay, severe to profound intellectual disability, congenital microcephaly, cortical polymicrogyria, lissencephaly, reduced central white matter volume, and drug-resistant epilepsy, lack of speech, absent ambulation and a progressive neurodegenerative course in most patients. Early death may occur in some patients.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_08359353R → C in NEDMCMS; increased homodimerization; even in absence of oxidative stress. 1 Publication1
Natural variantiVAR_08359455D → A in NEDMCMS; unknown pathological significance. 1 Publication1
Natural variantiVAR_08359556G → R in NEDMCMS; unknown pathological significance. 1 Publication1
Natural variantiVAR_08359662D → H in NEDMCMS; unknown pathological significance. 1 Publication1
Natural variantiVAR_083597109D → G in NEDMCMS; unknown pathological significance. 1 Publication1
Natural variantiVAR_083598117I → V in NEDMCMS; unknown pathological significance. 1 Publication1
Natural variantiVAR_083599178A → T in NEDMCMS; unknown pathological significance. 1 Publication1
Natural variantiVAR_083600205R → Q in NEDMCMS; changed alternative splicing; decreased protein abundance; homozygous patient cells show decreased mitochondrial respiratory reserve capacity and compensatory increased glycolytic activity. 2 Publications1
Natural variantiVAR_083601231R → W in NEDMCMS; increased homodimerization; even in absence of oxidative stress. 1 Publication1
Natural variantiVAR_083602253 – 296Missing in NEDMCMS. 1 PublicationAdd BLAST44

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi170C → G: Increased homodimerization even in absence of oxidative stress. 1 Publication1

Keywords - Diseasei

Disease mutation, Lissencephaly, Mental retardation, Neurodegeneration

Organism-specific databases

DisGeNET

More...
DisGeNETi
51075
MIMi618730, phenotype

Open Targets

More...
OpenTargetsi
ENSG00000213593

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164726611

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9Y320, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TMX2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74735249

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 48Sequence analysisAdd BLAST48
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000031575249 – 296Thioredoxin-related transmembrane protein 2Add BLAST248

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei211PhosphoserineCombined sources1
Modified residuei243PhosphoserineCombined sources1
Modified residuei288PhosphoserineCombined sources1

Keywords - PTMi

Disulfide bond, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9Y320

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9Y320

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9Y320

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y320

PeptideAtlas

More...
PeptideAtlasi
Q9Y320

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y320

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
85962 [Q9Y320-1]
85963 [Q9Y320-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y320

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y320

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9Y320

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000213593, Expressed in cortex of kidney and 238 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9Y320, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Y320, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000213593, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer (PubMed:31735293). Homodimer; disulfide-linked (PubMed:31735293). Occurs in both reduced and oxidized monomeric form (PubMed:31735293). Oxidative conditions increase homodimerization (PubMed:31735293).

Interacts with CANX (PubMed:31735293).

Interacts with ATP2A2 (PubMed:31735293).

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Q9Y320
With#Exp.IntAct
AGPAT3 [Q9NRZ7]3EBI-6447886,EBI-2803601
AGPAT4 [Q9NRZ5]3EBI-6447886,EBI-1754287
AGPAT5 [Q9NUQ2]3EBI-6447886,EBI-6916385
AIG1 - isoform 2 [Q9NVV5-2]3EBI-6447886,EBI-11957045
AQP6 [Q13520]3EBI-6447886,EBI-13059134
ARV1 [Q9H2C2]3EBI-6447886,EBI-11724186
ASGR1 [P07306]3EBI-6447886,EBI-1172335
ASPH - isoform 6 [Q12797-6]3EBI-6447886,EBI-12092171
BET1 [O15155]3EBI-6447886,EBI-749204
BNIP1 [Q12981]3EBI-6447886,EBI-4402847
BNIP2 [Q12982]3EBI-6447886,EBI-752094
BNIP3 [Q12983]3EBI-6447886,EBI-749464
BRICD5 - isoform 2 [Q6PL45-2]3EBI-6447886,EBI-12244618
BTN2A2 [Q8WVV5]3EBI-6447886,EBI-8648738
C16orf58 [Q96GQ5]3EBI-6447886,EBI-8636004
C2CD2L [O14523]3EBI-6447886,EBI-12822627
CCDC167 [Q9P0B6]3EBI-6447886,EBI-9083477
CCL2 [P13500]3EBI-6447886,EBI-1034732
CD81 [P60033]3EBI-6447886,EBI-712921
CDIPT [O14735]3EBI-6447886,EBI-358858
CDS2 [O95674]3EBI-6447886,EBI-3913685
CMTM7 [Q96FZ5]3EBI-6447886,EBI-2807956
COL8A2 [Q4VAQ0]3EBI-6447886,EBI-10241815
COX20 [Q5RI15]3EBI-6447886,EBI-2834035
CTXN3 [Q4LDR2]3EBI-6447886,EBI-12019274
CXorf66 [Q5JRM2]3EBI-6447886,EBI-12823659
CYBC1 [Q9BQA9]3EBI-6447886,EBI-2680384
CYP4F2 [P78329]3EBI-6447886,EBI-1752413
DERL1 [Q9BUN8]3EBI-6447886,EBI-398977
DGAT2L6 [Q6ZPD8]3EBI-6447886,EBI-12831978
EMD [P50402]3EBI-6447886,EBI-489887
EMP3 [P54852]3EBI-6447886,EBI-3907816
FA2H [Q7L5A8]3EBI-6447886,EBI-11337888
FAM177A1 - isoform 2 [Q8N128-2]3EBI-6447886,EBI-12201693
FAM241B - isoform 2 [Q96D05-2]3EBI-6447886,EBI-12118888
FAM3C [Q92520]3EBI-6447886,EBI-2876774
FAXDC2 [Q96IV6]3EBI-6447886,EBI-12142299
FDFT1 [P37268]3EBI-6447886,EBI-714550
FUNDC2 [Q9BWH2]3EBI-6447886,EBI-714482
GIMAP1 [Q8WWP7]3EBI-6447886,EBI-11991950
GIMAP5 [Q96F15]3EBI-6447886,EBI-6166686
GJB2 [P29033]3EBI-6447886,EBI-3905204
HACD2 [Q6Y1H2]3EBI-6447886,EBI-530257
HHATL [Q9HCP6]3EBI-6447886,EBI-5916693
HMOX2 [P30519]3EBI-6447886,EBI-712096
HSD17B11 [Q8NBQ5]3EBI-6447886,EBI-1052304
HSD17B13 [Q7Z5P4]3EBI-6447886,EBI-18053395
HSD3B7 [Q9H2F3]3EBI-6447886,EBI-3918847
HTATIP2 - isoform 3 [Q9BUP3-3]3EBI-6447886,EBI-12937691
IER3 [P46695]3EBI-6447886,EBI-1748945
IER3IP1 [Q9Y5U9]3EBI-6447886,EBI-725665
IGFBP5 [P24593]3EBI-6447886,EBI-720480
INSIG2 [Q9Y5U4]3EBI-6447886,EBI-8503746
ITGAM [P11215]3EBI-6447886,EBI-2568251
LEPROT [O15243]3EBI-6447886,EBI-15672507
LEPROTL1 [O95214]3EBI-6447886,EBI-750776
LHFPL5 [Q8TAF8]3EBI-6447886,EBI-2820517
LRAT [O95237]3EBI-6447886,EBI-13291307
MALL [Q13021]3EBI-6447886,EBI-750078
MFF - isoform 5 [Q9GZY8-5]3EBI-6447886,EBI-11956541
MFSD14B [Q5SR56]3EBI-6447886,EBI-373355
MGLL [A0A0C4DFN3]3EBI-6447886,EBI-12866138
MGST3 [O14880]3EBI-6447886,EBI-724754
MIP [P30301]3EBI-6447886,EBI-8449636
MLN [P12872]3EBI-6447886,EBI-18053274
MS4A1 [P11836]3EBI-6447886,EBI-2808234
NAT8 [Q9UHE5]3EBI-6447886,EBI-2863634
NDUFA3 [O95167]3EBI-6447886,EBI-1246131
NINJ2 [Q9NZG7]3EBI-6447886,EBI-10317425
NRM [Q8IXM6]3EBI-6447886,EBI-10262547
NSDHL [Q15738]3EBI-6447886,EBI-4280135
NSG1 [P42857]3EBI-6447886,EBI-6380741
ORMDL2 [Q53FV1]3EBI-6447886,EBI-11075081
OTULINL [Q9NUU6]3EBI-6447886,EBI-6916492
PAEP [P09466]3EBI-6447886,EBI-465167
PEX16 [Q9Y5Y5]3EBI-6447886,EBI-981985
PKMYT1 - isoform 2 [Q99640-2]3EBI-6447886,EBI-12257782
PLP2 [Q04941]3EBI-6447886,EBI-608347
PNLIPRP1 [P54315]3EBI-6447886,EBI-8652812
PPGB [Q59EV6]3EBI-6447886,EBI-14210385
PRAF2 [O60831]3EBI-6447886,EBI-2506064
PRB1 [A5D903]3EBI-6447886,EBI-10173935
PTPN9 [P43378]3EBI-6447886,EBI-742898
RABAC1 [Q9UI14]3EBI-6447886,EBI-712367
REEP2 [Q9BRK0]3EBI-6447886,EBI-11337973
REEP4 [Q9H6H4]3EBI-6447886,EBI-7545592
RFT1 [Q96AA3]3EBI-6447886,EBI-6269616
RNF24 - isoform 2 [Q9Y225-2]3EBI-6447886,EBI-13044680
RTP2 [Q5QGT7]3EBI-6447886,EBI-10244780
SACM1L [Q9NTJ5]3EBI-6447886,EBI-3917235
SCAMP5 [Q8TAC9]3EBI-6447886,EBI-2695784
SCD [O00767]3EBI-6447886,EBI-2684237
SELENOK [Q9Y6D0]3EBI-6447886,EBI-9679163
SERF1B [O75920]3EBI-6447886,EBI-2115181
SERP2 [Q8N6R1]3EBI-6447886,EBI-749270
SFT2D1 [Q8WV19]3EBI-6447886,EBI-2854842
SFXN1 [Q9H9B4]3EBI-6447886,EBI-355861
SFXN3 [A0A1P0AYU5]3EBI-6447886,EBI-14193895
SLC22A18 [Q96BI1]3EBI-6447886,EBI-11721845
SLC35A1 [P78382]3EBI-6447886,EBI-12870360
SMAGP [Q0VAQ4]3EBI-6447886,EBI-10226799
SMCO4 [Q9NRQ5]3EBI-6447886,EBI-8640191
SMIM1 [B2RUZ4]3EBI-6447886,EBI-12188413
STATH [P02808]3EBI-6447886,EBI-738687
STX12 [Q86Y82]3EBI-6447886,EBI-2691717
STX3 [Q13277]3EBI-6447886,EBI-1394295
STX7 [O15400]3EBI-6447886,EBI-3221827
THBD [P07204]3EBI-6447886,EBI-941422
THSD7B [C9JKN6]3EBI-6447886,EBI-17192156
TMBIM6 [P55061]3EBI-6447886,EBI-1045825
TMEM115 [Q12893]3EBI-6447886,EBI-8633987
TMEM120A [Q9BXJ8]3EBI-6447886,EBI-727322
TMEM120B [A0PK00]3EBI-6447886,EBI-10171534
TMEM121 [Q9BTD3]3EBI-6447886,EBI-12155101
TMEM128 - isoform 2 [Q5BJH2-2]3EBI-6447886,EBI-10694905
TMEM140 [Q9NV12]3EBI-6447886,EBI-2844246
TMEM14B [Q9NUH8]3EBI-6447886,EBI-8638294
TMEM14C [Q9P0S9]3EBI-6447886,EBI-2339195
TMEM176A [Q96HP8]3EBI-6447886,EBI-2800645
TMEM189-UBE2V1 [I3L0A0]3EBI-6447886,EBI-12213001
TMEM201 - isoform 2 [Q5SNT2-2]3EBI-6447886,EBI-11994282
TMEM203 [Q969S6]3EBI-6447886,EBI-12274070
TMEM208 [Q9BTX3]3EBI-6447886,EBI-12876824
TMEM222 [Q9H0R3]3EBI-6447886,EBI-347385
TMEM239 - isoform 2 [Q8WW34-2]3EBI-6447886,EBI-11528917
TMEM254 [Q8TBM7]3EBI-6447886,EBI-11956809
TMEM50B [P56557]3EBI-6447886,EBI-12366453
TMEM51 [Q9NW97]3EBI-6447886,EBI-726044
TMEM65 [Q6PI78]3EBI-6447886,EBI-6656213
TMEM71 - isoform 2 [Q6P5X7-2]5EBI-6447886,EBI-12886878
TMEM86B [Q8N661]3EBI-6447886,EBI-2548832
TMEM97 [Q5BJF2]3EBI-6447886,EBI-12111910
itself3EBI-6447886,EBI-6447886
TPRG1 [Q6ZUI0]3EBI-6447886,EBI-17249488
TRAM1L1 [Q8N609]3EBI-6447886,EBI-11996766
TREX1 - isoform 1 [Q9NSU2-1]3EBI-6447886,EBI-16746122
TSNARE1 [A0AVG3]3EBI-6447886,EBI-12003468
TSPAN2 [O60636]3EBI-6447886,EBI-3914288
TTMP [Q5BVD1]3EBI-6447886,EBI-10243654
TVP23B [Q9NYZ1]3EBI-6447886,EBI-11343401
UBE2J1 [Q9Y385]3EBI-6447886,EBI-988826
UNC93A - isoform 2 [Q86WB7-2]3EBI-6447886,EBI-13356252
VAMP1 - isoform 2 [P23763-3]3EBI-6447886,EBI-12097582
VAMP3 [Q15836]3EBI-6447886,EBI-722343
VAMP4 [O75379]3EBI-6447886,EBI-744953
VAMP5 [O95183]3EBI-6447886,EBI-10191195
VAPA [Q9P0L0]3EBI-6447886,EBI-1059156
VAPB [O95292]3EBI-6447886,EBI-1188298
WFDC2 [Q14508]3EBI-6447886,EBI-723529
YIF1A [O95070]3EBI-6447886,EBI-2799703
YIPF1 [Q9Y548]3EBI-6447886,EBI-7850136
YIPF2 [Q9BWQ6]3EBI-6447886,EBI-751204
YIPF6 [Q96EC8]3EBI-6447886,EBI-751210
Q96FB23EBI-6447886,EBI-2857623

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
119266, 34 interactors

Protein interaction database and analysis system

More...
IntActi
Q9Y320, 178 interactors

Molecular INTeraction database

More...
MINTi
Q9Y320

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000278422

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9Y320, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1296
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Y320

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9Y320

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini114 – 269ThioredoxinPROSITE-ProRule annotationAdd BLAST156

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi293 – 296Di-lysine motif1 Publication4

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The thioredoxin domain lacks the 2 redox-active cysteines, suggesting that it lacks thioredoxin activity.Curated
The di-lysine motif confers endoplasmic reticulum localization for type I membrane proteins.1 Publication

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0914, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000003751

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_064868_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y320

Identification of Orthologs from Complete Genome Data

More...
OMAi
HVGNIFM

Database of Orthologous Groups

More...
OrthoDBi
1107509at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y320

TreeFam database of animal gene trees

More...
TreeFami
TF314606

Family and domain databases

Conserved Domains Database

More...
CDDi
cd02962, TMX2, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.30.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036249, Thioredoxin-like_sf
IPR013766, Thioredoxin_domain
IPR039101, TMX2
IPR037463, TMX2_thioredoxin_dom

The PANTHER Classification System

More...
PANTHERi
PTHR15853, PTHR15853, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00085, Thioredoxin, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52833, SSF52833, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51352, THIOREDOXIN_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y320-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAVLAPLIAL VYSVPRLSRW LAQPYYLLSA LLSAAFLLVR KLPPLCHGLP
60 70 80 90 100
TQREDGNPCD FDWREVEILM FLSAIVMMKN RRSITVEQHI GNIFMFSKVA
110 120 130 140 150
NTILFFRLDI RMGLLYITLC IVFLMTCKPP LYMGPEYIKY FNDKTIDEEL
160 170 180 190 200
ERDKRVTWIV EFFANWSNDC QSFAPIYADL SLKYNCTGLN FGKVDVGRYT
210 220 230 240 250
DVSTRYKVST SPLTKQLPTL ILFQGGKEAM RRPQIDKKGR AVSWTFSEEN
260 270 280 290
VIREFNLNEL YQRAKKLSKA GDNIPEEQPV ASTPTTVSDG ENKKDK
Length:296
Mass (Da):34,038
Last modified:November 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD646B16B3A5F0C6D
GO
Isoform 2 (identifier: Q9Y320-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     84-122: ITVEQHIGNIFMFSKVANTILFFRLDIRMGLLYITLCIV → M

Show »
Length:258
Mass (Da):29,642
Checksum:i961758FD51F5511B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3V155G3V155_HUMAN
Thioredoxin domain containing 14, i...
TMX2 TXNDC14, hCG_39765
115Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PSF0E9PSF0_HUMAN
Thioredoxin-related transmembrane p...
TMX2
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PRL5E9PRL5_HUMAN
Thioredoxin-related transmembrane p...
TMX2
86Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PLR1E9PLR1_HUMAN
Thioredoxin-related transmembrane p...
TMX2
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAG43122 differs from that shown. Reason: Frameshift.Curated
The sequence BAC11569 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti90I → T in AAS66642 (Ref. 6) Curated1
Sequence conflicti159I → V in AAS66642 (Ref. 6) Curated1
Sequence conflicti236D → S in AAG43122 (Ref. 5) Curated1
Sequence conflicti258N → S in BAD96778 (Ref. 7) Curated1
Sequence conflicti289D → E in BAD96778 (Ref. 7) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_08359353R → C in NEDMCMS; increased homodimerization; even in absence of oxidative stress. 1 Publication1
Natural variantiVAR_08359455D → A in NEDMCMS; unknown pathological significance. 1 Publication1
Natural variantiVAR_08359556G → R in NEDMCMS; unknown pathological significance. 1 Publication1
Natural variantiVAR_08359662D → H in NEDMCMS; unknown pathological significance. 1 Publication1
Natural variantiVAR_083597109D → G in NEDMCMS; unknown pathological significance. 1 Publication1
Natural variantiVAR_083598117I → V in NEDMCMS; unknown pathological significance. 1 Publication1
Natural variantiVAR_083599178A → T in NEDMCMS; unknown pathological significance. 1 Publication1
Natural variantiVAR_083600205R → Q in NEDMCMS; changed alternative splicing; decreased protein abundance; homozygous patient cells show decreased mitochondrial respiratory reserve capacity and compensatory increased glycolytic activity. 2 Publications1
Natural variantiVAR_083601231R → W in NEDMCMS; increased homodimerization; even in absence of oxidative stress. 1 Publication1
Natural variantiVAR_083602253 – 296Missing in NEDMCMS. 1 PublicationAdd BLAST44

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_03069684 – 122ITVEQ…TLCIV → M in isoform 2. 2 PublicationsAdd BLAST39

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF132965 mRNA Translation: AAD27740.1
AY358501 mRNA Translation: AAQ88865.1
AK297688 mRNA Translation: BAH12650.1
AK075359 mRNA Translation: BAC11569.1 Frameshift.
AF059753 mRNA Translation: AAG43122.1 Frameshift.
AY451237 mRNA Translation: AAS66642.1
AK223058 mRNA Translation: BAD96778.1
BC000666 mRNA Translation: AAH00666.1
BC093062 mRNA Translation: AAH93062.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44601.1 [Q9Y320-2]
CCDS7967.1 [Q9Y320-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001137484.1, NM_001144012.2 [Q9Y320-2]
NP_057043.1, NM_015959.3 [Q9Y320-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000278422; ENSP00000278422; ENSG00000213593 [Q9Y320-1]
ENST00000378312; ENSP00000367562; ENSG00000213593 [Q9Y320-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51075

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51075

UCSC genome browser

More...
UCSCi
uc001nlc.3, human [Q9Y320-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF132965 mRNA Translation: AAD27740.1
AY358501 mRNA Translation: AAQ88865.1
AK297688 mRNA Translation: BAH12650.1
AK075359 mRNA Translation: BAC11569.1 Frameshift.
AF059753 mRNA Translation: AAG43122.1 Frameshift.
AY451237 mRNA Translation: AAS66642.1
AK223058 mRNA Translation: BAD96778.1
BC000666 mRNA Translation: AAH00666.1
BC093062 mRNA Translation: AAH93062.1
CCDSiCCDS44601.1 [Q9Y320-2]
CCDS7967.1 [Q9Y320-1]
RefSeqiNP_001137484.1, NM_001144012.2 [Q9Y320-2]
NP_057043.1, NM_015959.3 [Q9Y320-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DJ0NMR-A137-260[»]
SMRiQ9Y320
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi119266, 34 interactors
IntActiQ9Y320, 178 interactors
MINTiQ9Y320
STRINGi9606.ENSP00000278422

Protein family/group databases

TCDBi1.I.1.1.3, the nuclear pore complex (npc) family

PTM databases

iPTMnetiQ9Y320
PhosphoSitePlusiQ9Y320
SwissPalmiQ9Y320

Polymorphism and mutation databases

BioMutaiTMX2
DMDMi74735249

Proteomic databases

EPDiQ9Y320
jPOSTiQ9Y320
MassIVEiQ9Y320
PaxDbiQ9Y320
PeptideAtlasiQ9Y320
PRIDEiQ9Y320
ProteomicsDBi85962 [Q9Y320-1]
85963 [Q9Y320-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
27473, 80 antibodies

Genome annotation databases

EnsembliENST00000278422; ENSP00000278422; ENSG00000213593 [Q9Y320-1]
ENST00000378312; ENSP00000367562; ENSG00000213593 [Q9Y320-2]
GeneIDi51075
KEGGihsa:51075
UCSCiuc001nlc.3, human [Q9Y320-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51075
DisGeNETi51075
EuPathDBiHostDB:ENSG00000213593.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TMX2
HGNCiHGNC:30739, TMX2
HPAiENSG00000213593, Low tissue specificity
MIMi616715, gene
618730, phenotype
neXtProtiNX_Q9Y320
OpenTargetsiENSG00000213593
PharmGKBiPA164726611

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0914, Eukaryota
GeneTreeiENSGT00390000003751
HOGENOMiCLU_064868_0_0_1
InParanoidiQ9Y320
OMAiHVGNIFM
OrthoDBi1107509at2759
PhylomeDBiQ9Y320
TreeFamiTF314606

Enzyme and pathway databases

PathwayCommonsiQ9Y320

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
51075, 319 hits in 881 CRISPR screens
EvolutionaryTraceiQ9Y320

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51075
PharosiQ9Y320, Tdark

Protein Ontology

More...
PROi
PR:Q9Y320
RNActiQ9Y320, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000213593, Expressed in cortex of kidney and 238 other tissues
ExpressionAtlasiQ9Y320, baseline and differential
GenevisibleiQ9Y320, HS

Family and domain databases

CDDicd02962, TMX2, 1 hit
Gene3Di3.40.30.10, 1 hit
InterProiView protein in InterPro
IPR036249, Thioredoxin-like_sf
IPR013766, Thioredoxin_domain
IPR039101, TMX2
IPR037463, TMX2_thioredoxin_dom
PANTHERiPTHR15853, PTHR15853, 1 hit
PfamiView protein in Pfam
PF00085, Thioredoxin, 1 hit
SUPFAMiSSF52833, SSF52833, 1 hit
PROSITEiView protein in PROSITE
PS51352, THIOREDOXIN_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTMX2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y320
Secondary accession number(s): B7Z4R4
, Q53G73, Q561W0, Q5J7Q7, Q8NBP9, Q9H3L1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: November 1, 1999
Last modified: August 12, 2020
This is version 163 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again