Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 154 (08 May 2019)
Sequence version 1 (01 Nov 1999)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Thioredoxin-related transmembrane protein 2

Gene

TMX2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Thioredoxin-related transmembrane protein 2
Alternative name(s):
Cell proliferation-inducing gene 26 protein
Thioredoxin domain-containing protein 14
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TMX2
Synonyms:TXNDC14
ORF Names:CGI-31, My009, PIG26, PSEC0045, UNQ237/PRO270
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30739 TMX2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616715 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9Y320

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini49 – 102ExtracellularSequence analysisAdd BLAST54
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei103 – 125HelicalSequence analysisAdd BLAST23
Topological domaini126 – 296CytoplasmicSequence analysisAdd BLAST171

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
51075

Open Targets

More...
OpenTargetsi
ENSG00000213593

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164726611

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TMX2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74735249

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 48Sequence analysisAdd BLAST48
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000031575249 – 296Thioredoxin-related transmembrane protein 2Add BLAST248

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei211PhosphoserineCombined sources1
Modified residuei243PhosphoserineCombined sources1
Modified residuei288PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9Y320

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9Y320

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9Y320

PeptideAtlas

More...
PeptideAtlasi
Q9Y320

PRoteomics IDEntifications database

More...
PRIDEi
Q9Y320

ProteomicsDB human proteome resource

More...
ProteomicsDBi
85962
85963 [Q9Y320-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9Y320

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9Y320

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9Y320

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000213593 Expressed in 228 organ(s), highest expression level in cortex of kidney

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9Y320 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9Y320 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA040282
HPA063763

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
TMEM14BQ9NUH84EBI-6447886,EBI-8638294

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119266, 30 interactors

Protein interaction database and analysis system

More...
IntActi
Q9Y320, 83 interactors

Molecular INTeraction database

More...
MINTi
Q9Y320

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000278422

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1296
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9Y320

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9Y320

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini114 – 269ThioredoxinPROSITE-ProRule annotationAdd BLAST156

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi293 – 296Di-lysine motif4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The thioredoxin domain lacks the 2 redox-active cysteines, suggesting that it lacks thioredoxin activity.By similarity
The di-lysine motif confers endoplasmic reticulum localization for type I membrane proteins.By similarity

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0914 Eukaryota
ENOG410XVTA LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000003751

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9Y320

Identification of Orthologs from Complete Genome Data

More...
OMAi
VEQHVGN

Database of Orthologous Groups

More...
OrthoDBi
1107509at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9Y320

TreeFam database of animal gene trees

More...
TreeFami
TF314606

Family and domain databases

Conserved Domains Database

More...
CDDi
cd02962 TMX2, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036249 Thioredoxin-like_sf
IPR013766 Thioredoxin_domain
IPR039101 TMX2
IPR037463 TMX2_thioredoxin_dom

The PANTHER Classification System

More...
PANTHERi
PTHR15853 PTHR15853, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00085 Thioredoxin, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52833 SSF52833, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51352 THIOREDOXIN_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9Y320-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAVLAPLIAL VYSVPRLSRW LAQPYYLLSA LLSAAFLLVR KLPPLCHGLP
60 70 80 90 100
TQREDGNPCD FDWREVEILM FLSAIVMMKN RRSITVEQHI GNIFMFSKVA
110 120 130 140 150
NTILFFRLDI RMGLLYITLC IVFLMTCKPP LYMGPEYIKY FNDKTIDEEL
160 170 180 190 200
ERDKRVTWIV EFFANWSNDC QSFAPIYADL SLKYNCTGLN FGKVDVGRYT
210 220 230 240 250
DVSTRYKVST SPLTKQLPTL ILFQGGKEAM RRPQIDKKGR AVSWTFSEEN
260 270 280 290
VIREFNLNEL YQRAKKLSKA GDNIPEEQPV ASTPTTVSDG ENKKDK
Length:296
Mass (Da):34,038
Last modified:November 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD646B16B3A5F0C6D
GO
Isoform 2 (identifier: Q9Y320-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     84-122: ITVEQHIGNIFMFSKVANTILFFRLDIRMGLLYITLCIV → M

Show »
Length:258
Mass (Da):29,642
Checksum:i961758FD51F5511B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3V155G3V155_HUMAN
Thioredoxin domain containing 14, i...
TMX2 TXNDC14, hCG_39765
115Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PLR1E9PLR1_HUMAN
Thioredoxin-related transmembrane p...
TMX2
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PRL5E9PRL5_HUMAN
Thioredoxin-related transmembrane p...
TMX2
86Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PSF0E9PSF0_HUMAN
Thioredoxin-related transmembrane p...
TMX2
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAG43122 differs from that shown. Reason: Frameshift at position 283.Curated
The sequence BAC11569 differs from that shown. Reason: Frameshift at position 282.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti90I → T in AAS66642 (Ref. 6) Curated1
Sequence conflicti159I → V in AAS66642 (Ref. 6) Curated1
Sequence conflicti236D → S in AAG43122 (Ref. 5) Curated1
Sequence conflicti258N → S in BAD96778 (Ref. 7) Curated1
Sequence conflicti289D → E in BAD96778 (Ref. 7) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_03069684 – 122ITVEQ…TLCIV → M in isoform 2. 2 PublicationsAdd BLAST39

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF132965 mRNA Translation: AAD27740.1
AY358501 mRNA Translation: AAQ88865.1
AK297688 mRNA Translation: BAH12650.1
AK075359 mRNA Translation: BAC11569.1 Frameshift.
AF059753 mRNA Translation: AAG43122.1 Frameshift.
AY451237 mRNA Translation: AAS66642.1
AK223058 mRNA Translation: BAD96778.1
BC000666 mRNA Translation: AAH00666.1
BC093062 mRNA Translation: AAH93062.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44601.1 [Q9Y320-2]
CCDS7967.1 [Q9Y320-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001137484.1, NM_001144012.2 [Q9Y320-2]
NP_057043.1, NM_015959.3 [Q9Y320-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000278422; ENSP00000278422; ENSG00000213593 [Q9Y320-1]
ENST00000378312; ENSP00000367562; ENSG00000213593 [Q9Y320-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51075

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51075

UCSC genome browser

More...
UCSCi
uc001nlc.3 human [Q9Y320-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF132965 mRNA Translation: AAD27740.1
AY358501 mRNA Translation: AAQ88865.1
AK297688 mRNA Translation: BAH12650.1
AK075359 mRNA Translation: BAC11569.1 Frameshift.
AF059753 mRNA Translation: AAG43122.1 Frameshift.
AY451237 mRNA Translation: AAS66642.1
AK223058 mRNA Translation: BAD96778.1
BC000666 mRNA Translation: AAH00666.1
BC093062 mRNA Translation: AAH93062.1
CCDSiCCDS44601.1 [Q9Y320-2]
CCDS7967.1 [Q9Y320-1]
RefSeqiNP_001137484.1, NM_001144012.2 [Q9Y320-2]
NP_057043.1, NM_015959.3 [Q9Y320-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DJ0NMR-A137-260[»]
SMRiQ9Y320
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119266, 30 interactors
IntActiQ9Y320, 83 interactors
MINTiQ9Y320
STRINGi9606.ENSP00000278422

PTM databases

iPTMnetiQ9Y320
PhosphoSitePlusiQ9Y320
SwissPalmiQ9Y320

Polymorphism and mutation databases

BioMutaiTMX2
DMDMi74735249

Proteomic databases

EPDiQ9Y320
jPOSTiQ9Y320
PaxDbiQ9Y320
PeptideAtlasiQ9Y320
PRIDEiQ9Y320
ProteomicsDBi85962
85963 [Q9Y320-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000278422; ENSP00000278422; ENSG00000213593 [Q9Y320-1]
ENST00000378312; ENSP00000367562; ENSG00000213593 [Q9Y320-2]
GeneIDi51075
KEGGihsa:51075
UCSCiuc001nlc.3 human [Q9Y320-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51075
DisGeNETi51075

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TMX2

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0079395
HGNCiHGNC:30739 TMX2
HPAiHPA040282
HPA063763
MIMi616715 gene
neXtProtiNX_Q9Y320
OpenTargetsiENSG00000213593
PharmGKBiPA164726611

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0914 Eukaryota
ENOG410XVTA LUCA
GeneTreeiENSGT00390000003751
InParanoidiQ9Y320
OMAiVEQHVGN
OrthoDBi1107509at2759
PhylomeDBiQ9Y320
TreeFamiTF314606

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TMX2 human
EvolutionaryTraceiQ9Y320

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51075

Protein Ontology

More...
PROi
PR:Q9Y320

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000213593 Expressed in 228 organ(s), highest expression level in cortex of kidney
ExpressionAtlasiQ9Y320 baseline and differential
GenevisibleiQ9Y320 HS

Family and domain databases

CDDicd02962 TMX2, 1 hit
InterProiView protein in InterPro
IPR036249 Thioredoxin-like_sf
IPR013766 Thioredoxin_domain
IPR039101 TMX2
IPR037463 TMX2_thioredoxin_dom
PANTHERiPTHR15853 PTHR15853, 1 hit
PfamiView protein in Pfam
PF00085 Thioredoxin, 1 hit
SUPFAMiSSF52833 SSF52833, 1 hit
PROSITEiView protein in PROSITE
PS51352 THIOREDOXIN_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTMX2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9Y320
Secondary accession number(s): B7Z4R4
, Q53G73, Q561W0, Q5J7Q7, Q8NBP9, Q9H3L1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: November 1, 1999
Last modified: May 8, 2019
This is version 154 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again